Tap / click on image to see more RealViewsTM
Sale Price $6.78.  
Original Price $7.95. Comp. value
Sale Price $2.26per sheet of tissue paper.
You save 15%

2022 Periwinkle Blue Damask Old World Tissue Paper

Qty:

Other designs from this category

About Tissue Paper

Sold by

Size: 10" x 14"

When you've gone through the trouble of finding the perfect present make sure it has the perfect presentation. Give your gifts a personal touch with custom tissue paper printed with your chosen artwork or text. Gift giving just went from fun to super-fun!

  • Dimensions: 10” l x 14” w
  • Full color edge-to-edge print
  • 10lb paper is great for wrapping jewelry, small gifts and party favors
  • 18lb paper is thicker than standard tissue paper and provides more padding for delicate or heavier items
  • Allows for easy stuffing
  • Not intended for food contact use

About This Design

2022 Periwinkle Blue Damask Old World Tissue Paper

2022 Periwinkle Blue Damask Old World Tissue Paper

2022 Periwinkle Blue Damask Old World Tissue Paper Periwinkle Damask Old World Tissue Paper 2022 Periwinkle Damask Old World Tissue Paper Damask old world design, damask motif element created by Kristie Hubler, in the 2022 Color of the Year periwinkle blue, with lighter tone / tint of periwinkle for a background color. Similar design at https://www.zazzle.com/damask_old_world_cream_yellow_tablecloth-256334957129875231 with different color damask repeat and background color. Thank you! Kristie Hubler http://zazzle.com/store/fabricatedframes/products fabricatedframescom@gmail.com damask, "old world", pattern, Mediterranean, periwinkle, vintage, "gift wrap", "tissue paper", blue

Customer Reviews

4.8 out of 5 stars rating2.8K Total Reviews
2547 total 5-star reviews145 total 4-star reviews47 total 3-star reviews25 total 2-star reviews42 total 1-star reviews
2,806 Reviews
Reviews for similar products
5 out of 5 stars rating
By Tracey G.March 8, 2024Verified Purchase
Custom 18lb Tissue Paper, Size: 10" x 14"
Love this paper I’ve been looking for something like this for a while now and it’s perfect I love the colors. I love this print I put two of the same papers together because my project was a bit bigger than the papers I ordered, but it turned out absolutely beautiful. I love it.
5 out of 5 stars rating
By Babcia K.January 30, 2024Verified Purchase
Custom 18lb Tissue Paper, Size: 21" x 29"
Zazzle Reviewer Program
Easy to work with, the colors were as shown online, the weight of the paper was nice. I turned an old refrigerator box into a bookshelf in a guest bedroom / reading room. The paper went on clean, the ink did not run when finish was applied. I love the way it turned out! Sharp, no muddied spots
5 out of 5 stars rating
By Janis B.January 3, 2026Verified Purchase
Custom 10lb Tissue Paper, Size: 10" x 14"
I had a small table I had just painted and wanted to add a bit of a romantic touch. This paper decoupaged on the top was just what it needed it always elicits oohs and aahs. Can’t wait to try more designs. .

Tags

Tissue Paper
damaskold worldpatternmediterraneanperiwinklevintagegift wraptissue paperblue2022
All Products
damaskold worldpatternmediterraneanperiwinklevintagegift wraptissue paperblue2022

Other Info

Product ID: 256705250458015326
Created on: 1/18/2022, 8:27 PM
Rating: G