Tap / click on image to see more RealViewsTM
Sale Price $14.34.  
Original Price $15.90. Comp. value
Sale Price $2.39per sheet of tissue paper.
You save 10%

2022 Periwinkle Blue Damask Old World Tissue Paper

Qty:

Other designs from this category

About Tissue Paper

Sold by

Size: 10" x 14"

When you've gone through the trouble of finding the perfect present make sure it has the perfect presentation. Give your gifts a personal touch with custom tissue paper printed with your chosen artwork or text. Gift giving just went from fun to super-fun!

  • Dimensions: 10” l x 14” w
  • Full color edge-to-edge print
  • 10lb paper is great for wrapping jewelry, small gifts and party favors
  • 18lb paper is thicker than standard tissue paper and provides more padding for delicate or heavier items
  • Allows for easy stuffing
  • Not intended for food contact use

About This Design

2022 Periwinkle Blue Damask Old World Tissue Paper

2022 Periwinkle Blue Damask Old World Tissue Paper

2022 Periwinkle Blue Damask Old World Tissue Paper Periwinkle Damask Old World Tissue Paper 2022 Periwinkle Damask Old World Tissue Paper Damask old world design, damask motif element created by Kristie Hubler, in the 2022 Color of the Year periwinkle blue, with lighter tone / tint of periwinkle for a background color. Similar design at https://www.zazzle.com/damask_old_world_cream_yellow_tablecloth-256334957129875231 with different color damask repeat and background color. Thank you! Kristie Hubler http://zazzle.com/store/fabricatedframes/products fabricatedframescom@gmail.com damask, "old world", pattern, Mediterranean, periwinkle, vintage, "gift wrap", "tissue paper", blue

Customer Reviews

4.8 out of 5 stars rating2.9K Total Reviews
2624 total 5-star reviews151 total 4-star reviews48 total 3-star reviews25 total 2-star reviews49 total 1-star reviews
2,897 Reviews
Reviews for similar products
5.0 out of 5 stars rating
5 out of 5 stars rating
By Babcia K.March 24, 2026Verified Purchase
Custom 10lb Tissue Paper, Size: 10" x 14"
What a gorgeous pattern! Struggled a bit on match for multiple sheets required to cover the drop leaf table, but happy with result! Paper stayed true to color, the 18 lb weight is easy to work with, Art as Furniture - love it.
5.0 out of 5 stars rating
5 out of 5 stars rating
By Carla B.May 3, 2026Verified Purchase
Custom 18lb Tissue Paper, Size: 18" x 24"
I loved this design. Was not sure what to do with 3, which is the minimum quantity Zazzle requires in order to print, maybe friends will ask me to make one for them! See more on my Instagram: @carlabange.
5.0 out of 5 stars rating
5 out of 5 stars rating
By Tracey G.March 8, 2024Verified Purchase
Custom 18lb Tissue Paper, Size: 10" x 14"
Love this paper I’ve been looking for something like this for a while now and it’s perfect I love the colors. I love this print I put two of the same papers together because my project was a bit bigger than the papers I ordered, but it turned out absolutely beautiful. I love it.

Tags

Tissue Paper
damaskold worldpatternmediterraneanperiwinklevintagegift wraptissue paperblue2022
All Products
damaskold worldpatternmediterraneanperiwinklevintagegift wraptissue paperblue2022

Other Info

Product ID: 256705250458015326
Created on: 1/18/2022, 8:27 PM
Rating: G