Tap / click on image to see more RealViewsTM
Sale Price $222.30.  
Original Price $247.00 Comp. value
per wallpaper roll
You save 10%

2025 Super Bowl Showdown Wallpaper

Qty:

Other designs from this category

About Wallpapers

Sold by

Style: Smooth Vinyl

Introducing our Peel and Stick Wallpaper, a game-changer for effortless room transformations. This high-quality wallpaper features a matte finish and a hassle-free peel-and-stick application, making it a breeze to revamp your living spaces. Choose from textured vinyl or smooth vinyl and six different sizes, including a swatch so you can test the application, and find that perfect fit, ranging from small accent walls to large room makeovers.

  • Easy Maintenance: The wallpaper's smooth surface allows for easy cleaning and maintenance, making it perfect for busy households or high-traffic areas.
  • Residue-free Removal: When it's time for a change, our wallpaper can be easily removed without leaving any residue or damaging your walls, allowing for a hassle-free transition.
  • Versatile Design Options: Choose from a wide range of captivating designs, patterns, and colors to suit your personal style and enhance the ambiance of any room.
  • DIY-Friendly: Our Peel and Stick Wallpaper is designed for easy DIY installation, making it accessible to anyone. No professional skills or tools are required, saving you time and money.
  • Need some guidance on hanging your wallpaper? Please check out our how-to guide here

About This Design

2025 Super Bowl Showdown  Wallpaper

2025 Super Bowl Showdown Wallpaper

Get ready for the biggest game of the year! Celebrate the Super Bowl 2025 clash between the Kansas City Chiefs and Philadelphia Eagles with this exclusive New Orleans edition design. Whether you're cheering from the stadium or hosting a game-day party, this bold and dynamic design is perfect for t-shirts, hoodies, mugs, phone cases, and more. Show off your team pride and commemorate this epic showdown in style!

Customer Reviews

4.1 out of 5 stars rating7 Total Reviews
5 total 5-star reviews0 total 4-star reviews1 total 3-star reviews0 total 2-star reviews1 total 1-star reviews
7 Reviews
Reviews for similar products
5 out of 5 stars rating
By Tiffany A.March 27, 2026Verified Purchase
Custom Wallpaper 2' x 4', Textured vinyl
Better than anticipated. Just the right pattern and with an installer from Thumbtack, looks beyond seamless. A dreamy pattern I will forever be grateful for. .
5 out of 5 stars rating
By Charles K.August 15, 2025Verified Purchase
Custom Wallpaper 2' x 4', Textured vinyl
It is fabulous! Am always excited to show others. It is dramatic!!
5 out of 5 stars rating
By Suzanne R.September 18, 2025Verified Purchase
Custom Wallpaper 2' x 4', Textured vinyl
Great xxxxxxxccc. Yuyyyyyyyyyyyyyyyyyy.

Tags

Wallpapers
superbowl2025kansascitychiefsphiladelphiaeaglesnflfinalsgamedaymerchneworleansfootballfanstailgatepartychampionshipgearsportsmerch
All Products
superbowl2025kansascitychiefsphiladelphiaeaglesnflfinalsgamedaymerchneworleansfootballfanstailgatepartychampionshipgearsportsmerch

Other Info

Product ID: 256930944367092783
Created on: 2/9/2025, 2:30 AM
Rating: G 
Related Searches
wallpaperwallpaper