Tap / click on image to see more RealViewsTM
Sale Price $9.45.  
Original Price $10.50 Comp. value
each
You save 10%

Alchemy of Decay Phone Ring Stand

Qty:

Other designs from this category

About Ring Holders

Sold by
Product Technical Specifications

Style: Phone Ring Holder & Stand

Phone prone to slips and drops? Get a grip and try our custom phone ring holders! The ring can be adjusted to any angle needed for you to hold, hang, or prop your device. Add your favorite photos, patterns, and more to create a fun and functional accessory that stands out. Texting, taking selfies, and watching videos have never been easier or more comfortable.

  • Dimensions: 1.375”d (2.63” in length, including ring)
  • Material: silvertone metal
  • Compact and slim design (6.4mm)
  • Ring rotates 360° and flips 180° to adjust for any angle
  • Attaches securely to flat, non-textured surfaces
  • Removable; leaves no residue
  • Wipe surface clean, let air dry. Press firmly in place for 30 seconds.
  • Not compatible with magnetic car mounts

About This Design

Alchemy of Decay Phone Ring Stand

Alchemy of Decay Phone Ring Stand

Original Artwork by http://www.thedustyphoenix.com Digital art, no AI.

Customer Reviews

4.8 out of 5 stars rating51 Total Reviews
44 total 5-star reviews5 total 4-star reviews1 total 3-star reviews0 total 2-star reviews1 total 1-star reviews
51 Reviews
Reviews for similar products
5.0 out of 5 stars rating
5 out of 5 stars rating
By Courtney N.March 13, 2023Verified Purchase
Ring Holder
Zazzle Reviewer Program
Found this site when searching for a personalized gift best suited for a small group of teens & saw SO MANY OPTIONS! I was hoping the custom logo I created & uploaded wouldn’t add more processing time but I was pleasantly surprised to see my order was even better than I anticipated! AND more than a week SOONER than the originally expected delivery date!!! This was my first time doing something like this but will NOT be my last! .
5.0 out of 5 stars rating
5 out of 5 stars rating
By Jocelyn B.December 12, 2020Verified Purchase
Ring Holder
Zazzle Reviewer Program
The product is super durable and the grip toggle nice and firm yet easy to adjust positioning of. A great design, means I can hold my phone much more safely as well as stand it at different angles if needed. The piece to peel off is on the entire back of the grip when received, though it's not super easy to tell, just lift carefully with a fingernail end and peel off. The grip sticks well to the phone, is very stable and immobile once adhered. Know exactly where you want it before pressing it on. The printing was fine, colours were quite true to what I saw on my personal screen. Fine small lines turned out well. The artist's Mandala design is gorgeous.
5.0 out of 5 stars rating
5 out of 5 stars rating
By Precious T.September 6, 2021Verified Purchase
Ring Holder
Creator Review
Excellent product quality! I'm very happy:-). I'm very satisfied and happy with the print quality of my dog's photo.

Tags

Ring Holders
plaguemaskdoctordeathsicknessdarkdarkfantasyfantasysteampunkplaguemask
All Products
plaguemaskdoctordeathsicknessdarkdarkfantasyfantasysteampunkplaguemask

Other Info

Product ID: 256805446436610104
Created on: 3/10/2024, 3:54 PM
Rating: G