Art Nouveau DIY Christmas Cupcake Wrappers Wraps (Front)Art Nouveau DIY Christmas Cupcake Wrappers Wraps (Back)Art Nouveau DIY Christmas Cupcake Wrappers Wraps (Standing Front)
Art Nouveau DIY Christmas Cupcake Wrappers Wraps (Front/Back)
Sale Price $2.04.  
Original Price $2.40 Comp. value
per sheet
You save 15%

Art Nouveau DIY Christmas Cupcake Wrappers Wraps

4.5 out of 5 stars rating
4317 Total Reviews
| by Imagina
View Product Details

Popular from this Department

About Paper Sheets

Sold by

Size: 8.5" x 11"

A flat sheet of paper has unlimited possibilities; from flyers to paper airplanes and everything in between, the world is your oyster! Go and conquer.

  • Dimensions: 8.5" L x 11" H (portrait); 11" L x 8.5" H (landscape)
  • High-quality, full-color, full-bleed printing
  • Print on both sides
  • Add personal photos and text for no additional upcharge
  • Please note that the optional envelopes for this size of paper are larger than standard sized envelopes. The US Postal Service classifies them as Large Envelopes which will require significantly more postage to mail than standard envelopes.
  • 100% satisfaction guarantee
  • Let us print for you! Select your desired quantity for any project big or small

Paper Type: Thin Matte Paper

Crisp, clean, and professional—our Thin Matte paper is lightweight yet polished, making it ideal for business mailings, flyers, and folded pieces that need a refined, no-glare finish.

  • Made in Italy, printed in the USA
  • Contains 50% recycled content (10% post-consumer, 40% pre-consumer waste)

About This Design

Art Nouveau DIY Christmas Cupcake Wrappers Wraps

Art Nouveau DIY Christmas Cupcake Wrappers Wraps

These elegant Art Nouveau cupcake wrappers coordinate with the Alphonse Mucha Poinsettia Christmas Collection. Only two are overtly for Christmas, so if you order more than you need for your Christmas party, you can save some for another party on. They would also be lovely for teas, showers, and Valentine parties. This set gives you a mix of orchid cupcake wrappers with fuchsia pink designs and script and orchid cupcake wrappers with fuchsia pink designs and script. Other colorways are available in my gallery. Description: Each sheet contains five different cupcake wrappers featuring Art Nouveau designs with heart, flower and bird motifs. From top down: 1. Floral motif with the words "Yum!" and "Something Yummy" in script. 2. Heart and flower motif. 3. Flower and heart motif with the word "merry" in script repeating across the upper border. 4. Birds and hearts with the word "Joyeux Noël" in script. 5. Bouquets of heart-shaped blossoms with the words "Freshly Baked" and "Cupcake" in script. Instructions: 1. Carefully cut out each wrapper. 2. Bake cupcakes in normal cupcake (muffin tin) liners. 3. Wrap cupcake wrapper around cupcake and secure ends with glue stick, tape or sticker. 4. Frost and decorate cupcakes and add a matching cupcake topper, if you wish. Please visit my gallery's Alphonse Mucha Christmas Poinsettias Collection for more colorways and other matching items.

Customer Reviews

4.5 out of 5 stars rating4.3K Total Reviews
3428 total 5-star reviews378 total 4-star reviews139 total 3-star reviews115 total 2-star reviews257 total 1-star reviews
4,317 Reviews
Reviews for similar products
5 out of 5 stars rating
By Yvonne H.January 20, 2026Verified Purchase
Flat Paper Sheet, Size: 8.5" x 11", Paper: Basic Semi-Gloss, Envelopes: No Envelopes
These were super cute, everyone at the shower loved them! It was a smidge tricky getting photos in the little boxes even etc but it just took patience, they were printed nicely. The envelopes that were suggested were giant, they were to put the unfolded item in I guess which I didn't want because the point was for it to be like a booklet so I just didn't use the envelopes. I had thought people would take them home but the back has little things for guests to fill out guessing names and weights of the baby etc that the mommy to be wanted to keep so we collected them for her to take home. It was cute!
5 out of 5 stars rating
By Lisa D.May 16, 2022Verified Purchase
Flat Paper Sheet, Size: 4.5" x 5.6", Paper: Basic Semi-Gloss, Envelopes: No Envelopes
Zazzle Reviewer Program
I love the quality of this product and love how well they turned out. I spent the extra to get the semi-gloss and I am so glad I did! The printing itself is good. However, there are many invitations you can see what looks to be lines from the printer rollers (forgive me I don’t know the technical term). It is barely noticeable, but I still noticed it. (Third picture shown). But they still look really good!
5 out of 5 stars rating
By Margo O.August 8, 2024Verified Purchase
Flat Paper Sheet, Size: 5.5" x 8.5", Paper: Basic Semi-Gloss, Envelopes: Blank White Envelopes
Creator Review
The design on the menu is beautiful. It was easy to personalize. . The print came out crystal clear. The print came out perfect.

Tags

Paper Sheets
christmascupcakewrapperswrapsdiychristmas partyholiday partypartyopen housefuchsia
All Products
christmascupcakewrapperswrapsdiychristmas partyholiday partypartyopen housefuchsia

Other Info

Product ID: 244611464883442763
Created on: 12/2/2010, 11:13 PM
Rating: G