Tap / click on image to see more RealViewsTM
Sale Price $2.04.  
Original Price $2.55 Comp. value
per card
You save 20%

Baby Girl Shower Invitation Coquette Bow Aesthetic

Qty:
Choose Your Format

Envelopes

Choose from blank envelopes or save time with addressable envelopes

Squared
+$0.20
+$0.25
+$0.25
+$0.25
+$0.25
Signature Matte
Overall Pick
18 pt thickness / 120 lb weight Soft white, soft eggshell texture
-$0.15
+$0.55
+$0.55
+$1.35
+$0.55

Other designs from this category

About Invitations

Sold by

Size: 5" x 7"

Make custom invitations and announcements for every special occasion! Choose from twelve unique paper types, two printing options, and six shape options to design a card that's perfect for you.

  • Dimensions: 5" x 7" (portrait or landscape)
  • Standard white envelope included
  • High quality, full-color, full-bleed
  • Add photos and text to both sides of this flat card at no extra charge
  • Two printing options available: Standard and High-Definition
  • 12 unique paper types and colors to choose from
  • Designer Tip: To ensure the highest quality print, please note that this product’s customizable design area measures 5" x 7". For best results please add 1/16" bleed.

Paper Type: Signature Matte

Our Signature Matte paper is a customer favorite—smooth to the touch with a soft eggshell texture that elevates any design. Its sturdy 18 pt weight and natural feel make it the ideal choice for timeless, sophisticated events.

  • Exclusively made for Zazzle
  • Made and Printed in the USA
  • FSC® Certified—sourced from responsibly managed forests that protect both people and planet

About This Design

Baby Girl Shower Invitation Coquette Bow Aesthetic

Baby Girl Shower Invitation Coquette Bow Aesthetic

Celebrate your little one in style with this coquette-inspired baby shower invitation featuring soft shades of pink, a delicate lined background, and a charming bow design for that timeless feminine touch. Perfect for moms-to-be who love the romantic coquette aesthetic, this invitation blends elegance, sweetness, and modern charm. Whether you’re planning a classic pink baby shower, a girly tea party theme, or a stylish bow-inspired celebration, this design sets the tone for a beautiful gathering. The blush tones and dainty details make it a versatile choice for baby girls, while the pretty bow motif adds a touch of vintage-inspired grace.

Customer Reviews

4.8 out of 5 stars rating11.1K Total Reviews
9961 total 5-star reviews797 total 4-star reviews134 total 3-star reviews64 total 2-star reviews123 total 1-star reviews
11,079 Reviews
Reviews for similar products
5 out of 5 stars rating
By Deborah B.July 9, 2019Verified Purchase
Flat Invitation, Size: 5" x 7", Paper: Signature Matte, Corner: Squared, Envelopes: White, Print Quality: Standard
Zazzle Reviewer Program
The card was great. I love ability to include information on back and that there is a follow through from front of card. The card stock was just as described. Colors of gold, pink and accents were great. The color showed up perfectly on the card. Nothing was overpowering. The pineapple graphic made it perfect of my Hawaiian theme
5 out of 5 stars rating
By JoLynn L.August 10, 2020Verified Purchase
Flat Invitation, Size: 5" x 7", Paper: Signature Matte, Corner: Squared, Envelopes: White, Print Quality: Standard
Zazzle Reviewer Program
Loved the ease of ordering and prices. These were exactly what my daughter wanted. The order came quickly and were amazing quality. The entire theme came together from this inspiration.
5 out of 5 stars rating
By Jamilex A.November 20, 2021Verified Purchase
Flat Invitation, Size: 5" x 7", Paper: Signature Matte, Corner: Squared, Envelopes: White, Print Quality: Standard
Zazzle Reviewer Program
I was very impressed with the quality of the product I ordered. Not only was it my first time ordering off Zazzle but my order got here so much sooner than anticipated. I would definitely recommend! Wonderful! Exactly how described & previewed.

Tags

Invitations
pinkbowcoquettebabyshowernewarrivaldaintyfemininevintage
All Products
pinkbowcoquettebabyshowernewarrivaldaintyfemininevintage

Other Info

Product ID: 256578938762529566
Created on: 9/22/2025, 11:50 AM
Rating: G