Tap / click on image to see more RealViewsTM
No neon ink will be used when printing. Neon colors may appear darker than what you see on your screen.
Sale Price $37.92.  
Original Price $47.40. Comp. value
Sale Price $3.16per drink mix pack.
You save 20%

Bach & Boozy Neon Green & Pink Tropical Weekend Margarita Drink Mix

Qty:
Personalize this template

Other designs from this category

Shop this collection

 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 

About Drink Mixes

Sold by

Style: Margarita Drink Mix

Cheers!!! Our personalized Margarita Favors are the perfect personalized addition to your celebration. The Margarita is the No. 1 selling cocktail in the world and evokes a sense of paradise, the laid-back lifestyle and a tropical retreat. Sounds like the perfect party favor for your guests!
Personalized packages of cocktail drink mix make a favor idea that’s in step with the latest trends. Celebrate with your very own signature cocktail! Our cocktail mixes will help make your celebration fun and memorable.

  • Proudly made in the USA
  • Single serving of premium drink mix
  • Comes sealed in a beautiful white gloss pouch
  • Instructions are on the back on how to mix the pouch contents with other ingredients to make the perfect cocktail
  • Great For Gifts and Favors
  • Easily self assembled with self-adhesive labels
  • Purchase pre-assembled for an upcharge
  • Dimensions: 4"w x 5.5"h
  • Non-Alcoholic

Nutrition Facts: Servings: 1, Serv. Size: 28 g, Amount per serving: Calories 110, Total Fat 0g (0%DV), Sat. Fat 0g (0% DV), Trans Fat 0g, Cholest. 10mg (0% DV), Sodium 0mg (0% DV). Total Carb. 27g (10% DV), Fiber 0g (0% DV), Total Sugars 26g, (Incl. O Added Sugars, 0% DV) Protein 0g, Calcium 60mg (4% DV), Not a significant source of Vit. A, Vit. D and Iron. Percent Daily Values (DV) are based on a 2,000 calorie diet.
INGREDIENTS: Pure Cane Sugar, Citric Acid, Natural and Artificial Flavor, Silicone Dioxide, Tricalcium Phosphate, Xanthan Gum, Arabic Gum, Color (Blue #1), Color (Yellow#5)

About This Design

No neon ink will be used when printing. Neon colors may appear darker than what you see on your screen.
Bach & Boozy Neon Green & Pink Tropical Weekend Margarita Drink Mix

Bach & Boozy Neon Green & Pink Tropical Weekend Margarita Drink Mix

This bright and fun neon green & pink invite is ready to customize for a bach party!

Customer Reviews

4.7 out of 5 stars rating12 Total Reviews
9 total 5-star reviews2 total 4-star reviews1 total 3-star reviews0 total 2-star reviews0 total 1-star reviews
12 Reviews
Reviews for similar products
5 out of 5 stars rating
By Nicole N.May 12, 2023Verified Purchase
Custom Tea, Non-Assembled
Zazzle Reviewer Program
These were perfect for our wellness retreat! The tea was also really good. .
5 out of 5 stars rating
By Melanie B.February 1, 2024Verified Purchase
Custom Tea, Assembled
Zazzle Reviewer Program
We bought this as part of a class gift for our tea loving teacher. I could not have been more pleased. Excellent, top quality item. I was so impressed with how perfect they arrived. No complaints, only praise here. They were more beautiful than I expected and they made the most perfect gift. The printing honestly exceeded my expectations. Clear, crisp and vibrant.
5 out of 5 stars rating
By Sandra P.August 5, 2022Verified Purchase
Custom Tea, Non-Assembled
Zazzle Reviewer Program
The tea bags are a perfect fit for the special tea cups ordered for a bridal shower. The template was easy to edit and the labels easy to apply to the tea bags. I love them so much I am placing a second order. Perfect! Exactly as it appeared on the template.

Tags

Drink Mixes
neonpinkgreentropicalpalmtreesleavesmiamiweekendbachelorette
All Products
neonpinkgreentropicalpalmtreesleavesmiamiweekendbachelorette

Other Info

Product ID: 256319000367743175
Created on: 2/15/2024, 11:16 AM
Rating: G