Tap / click on image to see more RealViewsTM
Sale Price $8.08.  
Original Price $9.50 Comp. value
per sticker
You save 15%

Black Bear Silhouettes Wildlife Vinyl Sticker Set

Qty:

Other designs from this category

About Custom-Cut Vinyl Stickers

Sold by

Sticker Sheet Size: Medium 6" x 6" Sheet

Contour kiss-cut vinyl stickers have never been this custom before! Now you can design your own personalized stickers and we’ll use our patented laser kiss-cut technology perfectly around them for you, die-cut style! You can add a single design to create one perfect sticker, or add multiple different designs to a sheet and create a sheet of stickers, each beautifully printed and individually kiss-cut. Zazzle’s custom kiss-cut stickers allow you to create and make your unique style really stick!

  • Sheet Dimensions: 6" L x 6.5" H
  • Design Area: 6" L x 6" H
  • Stickers are cut to the exact shape of your image on a vinyl sheet
  • Removable, low-tack adhesive leaves no sticky residue
  • Choice between matte white, glossy white, or glossy transparent vinyl
  • Printed with solvent inks that are fade-proof, water-proof, and scratch-resistant
  • Available in 6 sizes
  • 0.125" border will be added around each sticker to protect your design and also help it stand out against any background
⚠️ WARNING! Choking hazard — Small parts; Not for children under 3 years.

About This Design

Black Bear Silhouettes Wildlife Vinyl Sticker Set

Black Bear Silhouettes Wildlife Vinyl Sticker Set

Black Bear Silhouettes Oval and Die Cut Vinyl Stickers. Stick these black bear vinyl decals to your laptop, phone, notebook, water bottle, bicycle helmet, skateboard, guitar case or even your car. These durable wildlife stickers are waterproof and fade proof. A cool design for explorers who enjoy hiking, camping, and traveling to national parks. Available in assorted sizes up to 14” wide. Visit Jenn's Doodle World for even more nature stickers and animal silhouette stickers and accessories.

Customer Reviews

4.5 out of 5 stars rating1.1K Total Reviews
889 total 5-star reviews64 total 4-star reviews27 total 3-star reviews27 total 2-star reviews79 total 1-star reviews
1,086 Reviews
5 out of 5 stars rating
By Barbara D.July 15, 2020Verified Purchase
Medium 6" x 6" Sheet Custom-Cut Vinyl Stickers, Matte White
Zazzle Reviewer Program
Sticks really well on licence plate. Print turned out really cute.
Reviews for similar products
5 out of 5 stars rating
By Jenn K.August 20, 2019Verified Purchase
Medium 6" x 6" Sheet Custom-Cut Vinyl Stickers, Matte White
Creator Review
Good quality vinyl stickers that stick well but also can be removed without residue. Funny eyes for all sorts of stuff. Printing turned out great and looks just as it appears online.
5 out of 5 stars rating
By Aurelia T.May 5, 2022Verified Purchase
Extra-Large 14" x 14" Sheet Custom-Cut Vinyl Stickers, Matte White
Zazzle Reviewer Program
I was able to give us a designer the dimensions of my mini shot glasses and she was able to reduce all the labels onto one sheet we’re all I did was going to change the names and add the table number for my seating chart absolutely perfect. Simple perfect easy to read fit great on my jar

Tags

Custom-Cut Vinyl Stickers
black bearbearsilhouettewildlifeanimalwildcampinghikingoutdoorsnational parks
All Products
black bearbearsilhouettewildlifeanimalwildcampinghikingoutdoorsnational parks

Other Info

Product ID: 256980266642531566
Created on: 3/22/2019, 10:17 PM
Rating: G