Sell on Zazzle
Tap / click on image to see more RealViewsTM
Sale Price $4.98.  
Original Price $5.85 Comp. value
per sticker
You save 15%

Black Bear with Cubs Silhouettes Vinyl Sticker Set

4.5 out of 5 stars rating
1090 Total Reviews |
by
Qty:
Sticker Sheet Size
Media

Other designs from this category

About Custom-Cut Vinyl Stickers

Sold by
Custom-Cut Vinyl Sticker
Create your own from scratch

Sticker Sheet Size: Small 4" x 4" Sheet

Design your own custom contour kiss-cut vinyl stickers. Upload one design for a single standout sticker, or add up to 30 different designs per sheet. Each sticker is individually kiss-cut with precision laser technology to match the exact shape of your artwork, giving you that clean die-cut look on an easy-peel vinyl sheet.

  • Sheet Size: 4" L x 4.5" W
  • Design Area: 4" L x 4" W
  • Up to 30 contour-cut stickers per sheet
  • Each sticker is cut to the exact shape of your image
  • Removable, low-tack adhesive that peels clean with no residue
  • Available in matte white, glossy white, or glossy transparent vinyl
  • Printed with solvent inks: fade-proof, waterproof, and scratch-resistant
  • Available in 6 sizes
  • A 0.125" border is added around each sticker to protect your design and help it pop on any surface
⚠️ WARNING! Choking hazard. Small parts. Not for children under 3 years.

About This Design

Black Bear with Cubs Silhouettes Vinyl Sticker Set

Black Bear with Cubs Silhouettes Vinyl Sticker Set

Walking Mama Black Bear with Baby Cubs Silhouettes. Stick these cute bear vinyl decals to your laptop, phone, notebook, water bottle, guitar case or even your car. These durable wildlife stickers are waterproof and fade proof. A cool design for explorers who enjoy hiking, camping, and traveling to national parks. Available in assorted sizes up to 14” wide. Visit Jenn's Doodle World for even more nature stickers and animal silhouette stickers and accessories.
Jenn's Doodle World
Pro
Artwork designed by
Orange County, CA
View their Store

Customer Reviews

4.5 out of 5 stars rating1.1K Total Reviews
893 total 5-star reviews64 total 4-star reviews27 total 3-star reviews27 total 2-star reviews79 total 1-star reviews
1,090 Reviews
Reviews for similar products
5 out of 5 stars rating
By Jenn K.August 20, 2019 • Verified Purchase
Medium 6" x 6" Sheet Custom-Cut Vinyl Stickers, Matte White
Creator Review
Good quality vinyl stickers that stick well but also can be removed without residue. Funny eyes for all sorts of stuff. Printing turned out great and looks just as it appears online.
5 out of 5 stars rating
By Aurelia T.May 5, 2022 • Verified Purchase
Extra-Large 14" x 14" Sheet Custom-Cut Vinyl Stickers, Matte White
Zazzle Reviewer Program
I was able to give us a designer the dimensions of my mini shot glasses and she was able to reduce all the labels onto one sheet we’re all I did was going to change the names and add the table number for my seating chart absolutely perfect. Simple perfect easy to read fit great on my jar
5 out of 5 stars rating
By Nichole M.August 9, 2020 • Verified Purchase
Large 8" x 8" Sheet Custom-Cut Vinyl Stickers, Matte White
Zazzle Reviewer Program
These turned out so beautifully and all our guests loved them!! They did not have the orange suit sleeves so I ordered them separately and they fit perfectly into the mailing envelope. I had an issue with the address labels not being ledge able and they redid them and replaced them. They are perfect!

Tags

Custom-Cut Vinyl Stickers
black bearbearsilhouettewildlifeanimalwildcampinghikingbear cubmama bear
All Products
black bearbearsilhouettewildlifeanimalwildcampinghikingbear cubmama bear

Other Info

Product ID: 256634622906341516
Created on: 3/22/2019, 10:20 PM
Rating: G 
Related Searches
black bear stickersbear stickersbear couple stickershoney bear 91teddy bear stickersmama bear stickerskoala bear stickersbear balloon stickersbambi stickersgummy bear stickers