Tap / click on image to see more RealViewsTM
Sale Price $44.84.  
Original Price $52.75 Comp. value
per wallpaper roll
You save 15%

Black Cat Halloween Wallpaper

Qty:

Other designs from this category

About Wallpapers

Sold by

Style: Textured vinyl

Introducing our Peel and Stick Wallpaper, a game-changer for effortless room transformations. This high-quality wallpaper features a matte finish and a hassle-free peel-and-stick application, making it a breeze to revamp your living spaces. Choose from textured vinyl or smooth vinyl and six different sizes, including a swatch so you can test the application, and find that perfect fit, ranging from small accent walls to large room makeovers.

  • Easy Maintenance: The wallpaper's smooth surface allows for easy cleaning and maintenance, making it perfect for busy households or high-traffic areas.
  • Residue-free Removal: When it's time for a change, our wallpaper can be easily removed without leaving any residue or damaging your walls, allowing for a hassle-free transition.
  • Versatile Design Options: Choose from a wide range of captivating designs, patterns, and colors to suit your personal style and enhance the ambiance of any room.
  • DIY-Friendly: Our Peel and Stick Wallpaper is designed for easy DIY installation, making it accessible to anyone. No professional skills or tools are required, saving you time and money.
  • Need some help hanging your wallpaper? Please check out our how-to guide here

About This Design

Black Cat Halloween Wallpaper

Black Cat Halloween Wallpaper

A sleek black cat with glowing green eyes sitting on a fence post, with a crescent moon in the background

Customer Reviews

4.1 out of 5 stars rating7 Total Reviews
5 total 5-star reviews0 total 4-star reviews1 total 3-star reviews0 total 2-star reviews1 total 1-star reviews
7 Reviews
Reviews for similar products
5 out of 5 stars rating
By Tiffany A.March 27, 2026Verified Purchase
Custom Wallpaper 2' x 4', Textured vinyl
Better than anticipated. Just the right pattern and with an installer from Thumbtack, looks beyond seamless. A dreamy pattern I will forever be grateful for. .
5 out of 5 stars rating
By Suzanne R.September 18, 2025Verified Purchase
Custom Wallpaper 2' x 4', Textured vinyl
Great xxxxxxxccc. Yuyyyyyyyyyyyyyyyyyy.
5 out of 5 stars rating
By Charles K.August 15, 2025Verified Purchase
Custom Wallpaper 2' x 4', Textured vinyl
It is fabulous! Am always excited to show others. It is dramatic!!

Tags

Wallpapers
blackcathalloweenwitchcraftdarknightscarypetfelinevintage
All Products
blackcathalloweenwitchcraftdarknightscarypetfelinevintage

Other Info

Product ID: 256578002974703449
Created on: 8/7/2024, 7:01 AM
Rating: G 
Related Searches
wallpaperwallpaper