Tap / click on image to see more RealViewsTM
Sale Price $1.90.  
Original Price $2.71 Comp. value
per card
You save 30%

Black White Simple Minimalist Elegant Wedding Invitation

Qty:
Choose Your Format

Envelopes

Choose from blank envelopes or save time with addressable envelopes

Squared
+$0.20
+$0.25
+$0.25
+$0.25
+$0.25
Signature Matte
Overall Pick
18 pt thickness / 120 lb weight Soft white, soft eggshell texture
+$1.44
+$0.59
+$0.59
+$0.59
-$0.16

Other designs from this category

About Invitations

Sold by

Size: 5" x 7"

Make custom invitations and announcements for every special occasion! Choose from six curated paper types, two printing options, and six shape options to design a card that's perfect for you.

  • Dimensions: 5" x 7" (portrait or landscape)
  • Envelopes included but can be removed if not needed
  • High quality, full-color, full-bleed
  • Add photos and text to both sides of this flat card at no extra charge
  • Two printing options available: Standard and High-Definition
  • 6 curated paper types to choose from
  • Designer Tip: To ensure the highest quality print, please note that this product’s customizable design area measures 5" x 7". For best results please add 1/16" bleed.

Paper Type: Signature Matte

Our Signature Matte paper is a customer favorite—smooth to the touch with a soft eggshell texture that elevates any design. Its sturdy 18 pt weight and natural feel make it the ideal choice for timeless, sophisticated events.

  • Exclusively made for Zazzle
  • Made and Printed in the USA
  • FSC® Certified—sourced from responsibly managed forests that protect both people and planet

About This Design

Black White Simple Minimalist Elegant Wedding Invitation

Black White Simple Minimalist Elegant Wedding Invitation

Celebrate your love with this Modern Black & White Minimalist Wedding Invitation, combining sleek design with natural elegance. Featuring clean lines, a refined serif typeface, and a tasteful white leaf motif at the base, this invitation is ideal for contemporary couples who appreciate understated beauty. With a solid dark background and elegant white typography, the design is both modern and timeless. The minimalist border and leaf accent add a subtle organic touch—perfect for garden weddings, modern ceremonies, or eco-conscious celebrations.

Customer Reviews

4.8 out of 5 stars rating32.7K Total Reviews
28756 total 5-star reviews2877 total 4-star reviews527 total 3-star reviews244 total 2-star reviews336 total 1-star reviews
32,740 Reviews
Reviews for similar products
5 out of 5 stars rating
By AnonymousFebruary 10, 2022Verified Purchase
Flat Invitation, Size: 5" x 7", Paper: Signature Matte, Corner: Squared, Envelopes: White, Print Quality: Standard
Zazzle Reviewer Program
We ordered this invitation first as just a sample because I loved the color combination. We ordered many other samples invitations (thanks to Zazzle Black). But ultimately ended up coming back to this (our first) because is simply was exactly what I was looking for. I actually ended up using the color pallet for our entire wedding! We had an outdoor ceremony and inside reception and these invitations were the perfect introduction for our guests to the type of event we were planning. Not too fancy but also not a casual evening wedding. The colors were vibrant and the paper was just the right amount of weight. We ordered the matching RSVP cards, the mauve envelopes with return address printed on the back, the belly bands to tie it all together, and the menus. Postage to send all this out was only .78 each. We highly recommend these invites and this seller was very responsive, our orders went out very timely. Thank you so much! We were so happy with all your paper products! I was extremely satisfied with the colors of our invitations. I couldn't have been happier with the print!
5 out of 5 stars rating
By Kathryn L.October 18, 2020Verified Purchase
Flat Invitation, Size: 5" x 7", Paper: Signature Matte, Corner: Squared, Envelopes: White, Print Quality: Standard
Zazzle Reviewer Program
The product exceeded my expectations and was of high quality. the paper was thick and was a perfect invitation for my wedding. the colors were just as expected and vibrant. I have no worries that those receiving the invitations will know how much work was put into the product.
5 out of 5 stars rating
By N.July 29, 2016Verified Purchase
Flat Invitation, Size: 5" x 7", Paper: Signature Matte, Corner: Squared, Envelopes: White, Print Quality: Standard
Zazzle Reviewer Program
It's ok to go with the paper they offer its similar, and the truth it's people does not care about them and this has so many things to write on to express yourself that it's what matters the most . Save one a do not worry about people , they truly don't care , it's more as oh they are getting married ok ! And some people will say oh they are fancy , I never did that , that at some point you will think you went over the top, but u did not . ! So clear if u are thinking of a pic of you guys pay extra for the brightness and whatever but the truth it's people don't care ....sorry so it's not worth to stress over them it's my conclusion . In the end they are just going too look at them and be like now we have to worry about one more thing and weddings are boring and food it's never good...and ceremony it's going to bored them. So don't make ceremony long , unless your going to make them cry with ur speech snd they are going to fall madly in love with u guys. Make it short , make it fun , don't worry about nobody else but you two , because the truth is you are the only ones that can make your marriage work nobody else .... And always remember whatever people say does not matter ... Follow your heart, if they are honest , humble , kind and understand you you will know they are the one , and others opinions don't matter. When u want something and love it you will go above and beyond to present wherever you want ; and will always make it look good !!!!!!

Frequently Asked Questions:

Ideally, you want to send out invitations 2-3 months before most events, such as birthdays. However, this isn’t always possible. If you can’t give that much notice, send them out as soon as all of the plans are confirmed. This will allow your guests as much time as possible to receive the invite and plan to accept the invitation.

However, the bigger and more important your event is, the more advanced notice you’ll want to give your guests. For example, wedding invitations can be sent even six months in advance.

Your invitations do not need to match the event theme, but doing so shows that you’re throwing a well-put-together occasion that suggests that every decision is intentional. Having a cohesive theme adds a nice detail that guests will surely appreciate.

High-definition printing is great for pictures that you want to pop and dial up the vibrancy with a high-definition digital printing process. We use CMYK inks plus a lighter shade of cyan and magenta, so we’re able to generate a broader range of colors to more accurately represent the real-life behind your photos. Skin tones and pastel colors have never looked better with high-definition printing. Your images will be brighter, more precise, and livelier.

While you can customize any existing design by going to a product page and selecting "Personalize" then "Edit using Design Tool," you can also create your own design completely from scratch through the following:

  • Step 1: Navigate to our "Personalized Custom Invitations & Announcement" page
  • Step 2: Find the product you want to add a design to and click on it to get to a page that features that product
  • Step 3: Select "Customize This Design"
  • Step 4: You’ll then enter our design tool, which you can use to add text, images, and more to completely customize your design

There are a number of paper types available to choose from in our paper collection. Our core paper types include Basic Semi-Gloss, Signature Matte, Signature Double-Thick, Premium Linen, Premium Pearlescent, and Premium Soft Touch. We only offer the highest quality paper options for our products.

Yes, our papers are not only recyclable but eco-friendly, and select papers are made with recycled content. We sourced, sampled, and carefully selected each paper offered in our three collections.

We have hundreds if not thousands of different invitation designs like Modern Wedding Invitations and many more to choose from. However, if none of these designs match your needs you can customize any existing design or make your own from scratch so that you can set the stage for a memorable celebration.

Here at Zazzle we provide a number of mailing accessories that can match your Black White Simple Minimalist Elegant Wedding Invitation for almost every event such as birthdays, weddings, and parties. You can choose from popular mailing accessories to go with your invitations including save the dates to send out ahead of your invitations, embossers for unique prints, return address labels, and more. With our large array of products and our design tool, it’s easy to create cohesive designs that will set the tone for your special occasion.

Yes! Our Independent Creators have worked hard to create many products as collections or in coordinating styles and new designs are added daily to many different products. Some popular supplies that match Black White Simple Minimalist Elegant Wedding Invitation include napkins and posters that are among our best sellers but we also have many more products you can look at.

It’s easy! Personalize, download & share in minutes rather than weeks. Purchasing a digital invitation gives you the flexibility to quickly send out event invitations and digitally save a copy of your invitation you can look at years later.

You can also choose to print your digital invitation on your printer, at a local print shop, from Zazzle, or all 3 if you want.

Yes, you can edit your digital invitation on Zazzle, after purchasing. There are no limitations as to when you can continue to edit and customize your digital invitation designs. You fully own the designs and rights, so you can continue to use our website and tools to edit your designs. You can print these designs on paper, and apply these designs to any product on Zazzle such as stickers.

This is true not only for digital invitations but any digital products you order on Zazzle.

Tags

Invitations
minimalistcontemporaryelegantstylishsimplesleekchicfashionabletrendysophisticated
All Products
minimalistcontemporaryelegantstylishsimplesleekchicfashionabletrendysophisticated

Other Info

Product ID: 256748467101373100
Created on: 9/27/2024, 8:23 AM
Rating: G