Tap / click on image to see more RealViewsTM
Sale Price $3.87.  
Original Price $4.30 Comp. value
per sticker
You save 10%

Blue Tile Mediterranean with Lemons Bridal Shower Sticker

1.0 out of 5 stars rating
1 Total Reviews |
by
Qty:
Sticker Sheet Size
Paper Type

Other designs from this category

About Custom-Cut Vinyl Stickers

Sold by
Custom-Cut Vinyl StickerCreate your own from scratch

Sticker Sheet Size: 3" x 3" Sheet

Design your own custom contour kiss-cut vinyl stickers. Upload one design for a single standout sticker, or add up to 30 different designs per sheet. Each sticker is individually kiss-cut with precision laser technology to match the exact shape of your artwork, giving you that clean die-cut look on an easy-peel vinyl sheet.

  • Sheet Size: 3" L x 3.5" W
  • Design Area: 3" L x 3" W
  • Up to 30 contour-cut stickers per sheet
  • Each sticker is cut to the exact shape of your image
  • Removable, low-tack adhesive that peels clean with no residue
  • Available in matte white, glossy white, or glossy transparent vinyl
  • Printed with solvent inks: fade-proof, waterproof, and scratch-resistant
  • Available in 6 sizes
  • A 0.125" border is added around each sticker to protect your design and help it pop on any surface
⚠️ WARNING! Choking hazard. Small parts. Not for children under 3 years.

About This Design

Blue Tile Mediterranean with Lemons Bridal Shower Sticker

Blue Tile Mediterranean with Lemons Bridal Shower Sticker

Celebrate the bride-to-be in refreshing Mediterranean style with the Blue Tile Mediterranean with Lemons Bridal Shower "She Found Her Main Squeeze" Sticker. Featuring elegant blue tile patterns paired with bright lemons and a charming citrus theme, this invitation is perfect for bridal showers, brunches, garden parties, or summer celebrations honoring the future bride. This is a fully editable template, allowing you to easily customize text, colors, and event details to match your celebration. No design experience required. Designed for both print and digital use, the template gives you flexible options for sharing or printing your invitation.
Lushlin Creative Designs
Artwork designed by
Suriname
View their Store

Customer Reviews

1.0 out of 5 stars rating1 Total Reviews
0 total 5-star reviews0 total 4-star reviews0 total 3-star reviews0 total 2-star reviews1 total 1-star reviews
1 Reviews
Reviews for similar products
1.0 out of 5 stars rating
1 out of 5 stars rating
By Cathy P.March 24, 2026 • Verified Purchase
8" x 8" Sheet Custom-Cut Vinyl Stickers, Matte White
The stickers were way too tiny.

Tags

Custom-Cut Vinyl Stickers
bacheloretteweekendinvitationbridalpartybridalweekenditinerarytemplateprintablebacheloretteinvitationlemonbridalshowerinvitationmediterraneanbridalinviteshefoundhermainsqueezebluetilebridalshowerbridallemonshowersticker
All Products
bacheloretteweekendinvitationbridalpartybridalweekenditinerarytemplateprintablebacheloretteinvitationlemonbridalshowerinvitationmediterraneanbridalinviteshefoundhermainsqueezebluetilebridalshowerbridallemonshowersticker

Other Info

Product ID: 256911995831173427
Created on: 6/22/2026, 11:52 AM
Rating: G