Tap / click on image to see more RealViewsTM
Sale Price $42.71.  
Original Price $50.24 Comp. value
each
You save 15%

Bottlenose Dolphins Ocean Fish Guest Book

Qty:
10.5" x 8.25"
-$11.17
+$22.36
Lined White 70# Uncoated Text

Other designs from this category

About Guest Books

Sold by

Style: 10.5" x 8.25" Guestbook

Crafted with meticulous attention to detail, these guest books are designed to elevate your special occasions, capturing memories with style and grace. The guest book features a cover made from premium paper, exuding an aura of elegance. The cover is further enhanced with a luxurious velvet lamination, adding a tactile charm that begs to be touched and admired. Inside, you'll find a harmonious blend of quality and aesthetics. The white lined pages are crafted from 70# uncoated text, providing a smooth surface that welcomes every stroke of the pen with grace and finesse. These pages serve as the canvas for your guests' heartfelt messages, well wishes, and memories, ensuring every word is captured with clarity and precision. For a touch of contrast, optional black pages made from 60# Eclipse paper create a striking backdrop for metallic and gel ink pens, allowing your guests' words to shine brightly against the darkness.

  • Dimensions: 8.25" x 10.5" (100 Pages)
  • Cover: 100# Mohawk uncoated text with velvet lamination
  • Internal Paper: White lined and unlined pages: 70# uncoated text, Black unlined pages: 60# Eclipse

About This Design

Bottlenose Dolphins Ocean Fish Guest Book

Bottlenose Dolphins Ocean Fish Guest Book

Gorgeous Ocean Underwater scene by Ronald Heinrich with Bottlenose Dolphins, Turtles and Fish with crashing waves and island Palm Trees above the waterline is on this Guest Book. Image is public domain due to released copyright.

Customer Reviews

4.8 out of 5 stars rating698 Total Reviews
636 total 5-star reviews33 total 4-star reviews9 total 3-star reviews9 total 2-star reviews11 total 1-star reviews
698 Reviews
5 out of 5 stars rating
By Patty f.March 5, 2019Verified Purchase
Size: 10.5" x 8.25", Paper: Lined White 70# Uncoated Text
Creator Review
The Book itself is absolutely wonderful. Sturdy and shiny and wonderful. I am actually going to use it as a journal which is why I removed the Guest Book words myself. Easy to add yourself it you want them back on. The Box it comes in just makes it a wonderful gift. Great Book. The printing turned out perfect. The colors are exactly like the image, the Dolphins swim towards you almost like in 3D. Great job printing!!!
Reviews for similar products
5 out of 5 stars rating
By Teresa L.May 15, 2024Verified Purchase
Size: 10.5" x 8.25", Paper: Lined White 70# Uncoated Text
Love Love Love this guestbook and it matches my programs and my wedding sign, The book was beautifully packaged and come in a cute box. It's very beautiful and love that it's hardback book.
5 out of 5 stars rating
By C Z.December 31, 2021Verified Purchase
Size: 10.5" x 8.25", Paper: Lined White 70# Uncoated Text
Zazzle Reviewer Program
My overall experience with ordering the book was great. It was easy to customize the book.The price of the book was reasonable and it arrived earlier than expected. The printing was excellent. The book turned out exactly like what was displayed on the website. The book cover and pages were made with good quality material. I also loved that the book came in an individual gift box. That was a great touch! I was extremely pleased with this product and would order from here again.

Tags

Guest Books
dolphinsoceanguest bookfishturtleswavesislandswildlifeanimalsaquatic
All Products
dolphinsoceanguest bookfishturtleswavesislandswildlifeanimalsaquatic

Other Info

Product ID: 256594565573721818
Created on: 2/16/2019, 1:05 AM
Rating: G 
Related Searches
guest bookguest books