• Events
Tap / click on image to see more RealViewsTM
Sale Price $7.56.  
Original Price $9.45 Comp. value
per sheet of 20
You save 20%

Caduceus Classic Round Sticker

Qty:
  1. Shape

  2. Format

  3. Size

  4. Paper Type

Other designs from this category

About Stickers

Sold by

Shape: Classic Round Stickers

Create custom stickers for every occasion! From special mailings and scrapbooking to kids' activities and DIY projects, you'll find these stickers are great for so many uses. Add your own designs, patterns, text, and pictures!

  • Dimensions: Available in 2 sizes:
    • Large: 3" diameter, 6 stickers per sheet
    • Small: 1.5" diameter, 20 stickers per sheet
  • Printed on white acid-free paper
  • Vibrant full-color, full-bleed printing
  • Scratch-resistant front, easy peel-and-stick back
  • Available in a matte or glossy finish
  • Choose between a variety of different shapes

About This Design

Caduceus Classic Round Sticker

Caduceus Classic Round Sticker

Design that makes caduceus motif

Customer Reviews

4.8 out of 5 stars rating26.9K Total Reviews
23233 total 5-star reviews2197 total 4-star reviews579 total 3-star reviews364 total 2-star reviews554 total 1-star reviews
26,927 Reviews
Reviews for similar products
5.0 out of 5 stars rating
5 out of 5 stars rating
By Michaela A.October 19, 2025Verified Purchase
Custom Classic Round Stickers, Format: Sheet of Stickers, Size: 1.5 inch, Paper Type: Glossy
I have reordered these now 3 times for my small business because they come in so fast and the quality is just absolutely unmatched. Will continue to repurchase for a LONG time!
5.0 out of 5 stars rating
5 out of 5 stars rating
By Donna M.January 26, 2026Verified Purchase
Custom Classic Round Stickers, Format: Sheet of Stickers, Size: 1.5 inch, Paper Type: Glossy
Loved these stickers. Colors are great…size 1 1/2” was perfect for many items at my baby shower. Stickie is great as well. I could easily reposition if needed. Highly recommend. Fast service too.
5.0 out of 5 stars rating
5 out of 5 stars rating
By Cynthia C.August 10, 2026Verified Purchase
Custom Classic Round Stickers, Format: Sheet of Stickers, Size: 3 inch, Paper Type: Matte
Order is always great but the delivery wasn't. Shipped July 13th, was lost, you re-made the order(which I thankyou) but than order was lost or delayed again .finally was delivered Aug. 5. Still will order them, hopefully you'll do better next time with shipping. .

Tags

caduceusmedicalsymbolmedicinegreekphysicianswandhermes

Other Info

Product ID: 217421214359186041
Created on: 4/25/2010, 1:28 PM
Rating: G