Tap / click on image to see more RealViewsTM
Sale Price $1.65.  
Original Price $1.93 Comp. value
per postcard
You save 15%

Caduceus Postcard

Qty:
Signature Matte
18 pt thickness / 120 lb weight Soft white, soft eggshell texture
-$0.18

Other designs from this category

About Postcards

Sold by

Size: Standard Postcard

Create your own vacation-worthy postcard! Any view you’ve seen, any monument you’ve fallen in love with, can all be added to your postcard with our personalization tool.

  • Dimensions: 5.6" L x 4.25" H; qualified USPS postcard size
  • High quality, full-color, full-bleed printing on both sides

Paper Type: Signature Matte

Our Signature Matte paper is a customer favorite—smooth to the touch with a soft eggshell texture that elevates any design. Its sturdy 18 pt weight and natural feel make it the ideal choice for timeless, sophisticated events.

  • Exclusively made for Zazzle
  • Made and Printed in the USA
  • FSC® Certified—sourced from responsibly managed forests that protect both people and planet

About This Design

Caduceus Postcard

Caduceus Postcard

Design that makes caduceus motif

Customer Reviews

4.9 out of 5 stars rating15.8K Total Reviews
14379 total 5-star reviews1007 total 4-star reviews203 total 3-star reviews77 total 2-star reviews126 total 1-star reviews
15,792 Reviews
Reviews for similar products
5 out of 5 stars rating
By Ray A.September 30, 2025Verified Purchase
Post Card, Size: Standard Postcard, Paper: Signature Matte, Envelopes: None
Very pleased with my order. All my prints were manufactured to a very high standard to my exact specifications and edited additions.
5 out of 5 stars rating
By Paul I.February 4, 2021Verified Purchase
Post Card, Size: Standard Postcard, Paper: Signature Matte, Envelopes: None
Creator Review
I had never seen these classic science fiction images and most of my friends have not seen them either. They are like little treasures! Amazing quality and fun to send people!
5 out of 5 stars rating
By Jennifer W.November 28, 2022Verified Purchase
Post Card, Size: Standard Postcard, Paper: Signature Matte, Envelopes: None
Zazzle Reviewer Program
I joined Postcrossing a few months ago and wanted postcards to represent my state well. I found them on Zazzle. I purchased numerous cards and was impressed with all of them. Excellent! The colors are beautiful. The cards have the exact look I wanted. I couldn't be happier.

Tags

Postcards
caduceusmedicalsymbolmedicinegreekphysicianswandhermes
All Products
caduceusmedicalsymbolmedicinegreekphysicianswandhermes

Other Info

Product ID: 239192120133082062
Created on: 4/25/2010, 1:19 PM
Rating: G 
Related Searches
postcardcustom postcard