Tap / click on image to see more RealViewsTM
Sale Price $1.74.  
Original Price $1.93 Comp. value
per postcard
You save 10%

Caduceus Postcard

Qty:
Signature Matte
18 pt thickness / 120 lb weight Soft white, soft eggshell texture
-$0.18

Other designs from this category

The Zazzle Promise

  • Order with Confidence

    If something goes wrong on our end, we'll make it right, on every order. Learn more!

  • FREE Shipping

    Enjoy FREE shipping with a 30-day free trial of Zazzle Plus – Learn More!

  • Secure Shopping Guaranteed

    100% Secure payment with SSL Encryption.

About Postcards

Sold by

Size: Standard Postcard

Create your own vacation-worthy postcard! Any view you’ve seen, any monument you’ve fallen in love with, can all be added to your postcard with our personalization tool.

  • Dimensions: 5.6" L x 4.25" H; qualified USPS postcard size
  • High quality, full-color, full-bleed printing on both sides

Paper Type: Signature Matte

Our Signature Matte paper is a customer favorite—smooth to the touch with a soft eggshell texture that elevates any design. Its sturdy 18 pt weight and natural feel make it the ideal choice for timeless, sophisticated events.

  • Exclusively made for Zazzle
  • Made and Printed in the USA
  • FSC® Certified—sourced from responsibly managed forests that protect both people and planet

About This Design

Caduceus Postcard

Caduceus Postcard

Design that makes caduceus motif

Customer Reviews

4.9 out of 5 stars rating15.9K Total Reviews
14463 total 5-star reviews1012 total 4-star reviews212 total 3-star reviews82 total 2-star reviews142 total 1-star reviews
15,911 Reviews
Reviews for similar products
5.0 out of 5 stars rating
5 out of 5 stars rating
By Ray A.September 30, 2025Verified Purchase
Post Card, Size: Standard Postcard, Paper: Signature Matte, Envelopes: None
Very pleased with my order. All my prints were manufactured to a very high standard to my exact specifications and edited additions.
5.0 out of 5 stars rating
5 out of 5 stars rating
By Suzi G.August 16, 2025Verified Purchase
Post Card, Size: Standard Postcard, Paper: Signature Matte, Envelopes: None
Fabulous create your own postcard turned out awesome 👍 I love the different colors and balloons a lot! .
5.0 out of 5 stars rating
5 out of 5 stars rating
By Suzi G.September 17, 2025Verified Purchase
Post Card, Size: Standard Postcard, Paper: Signature Matte, Envelopes: None
This tropical card is so good 1🙂🙂The colors, borders, text fonts, all added up to 💯% satisfied customer!!!! 👍.

Tags

Postcards
caduceusmedicalsymbolmedicinegreekphysicianswandhermes
All Products
caduceusmedicalsymbolmedicinegreekphysicianswandhermes

Other Info

Product ID: 239192120133082062
Created on: 4/25/2010, 1:19 PM
Rating: G