Tap / click on image to see more RealViewsTM
Sale Price $33.11.  
Original Price $38.95 Comp. value
per poster
You save 15%

Caduceus Poster

Qty:
Choose Your Format
Custom (17.05" x 19.98")
None

Other designs from this category

About Posters

Sold by

Paper Type: Value Poster Paper (Semi-Gloss)

Your walls are a reflection of your personality, so let them speak with your favorite quotes, art, or designs printed on our custom Giclee posters! High-quality, microporous resin-coated paper with a beautiful semi-gloss finish. Choose from standard or custom size posters and framing options to create art that’s a perfect representation of you.

  • Gallery quality Giclee prints
  • Ideal for vibrant artwork and photo reproduction
  • Semi-gloss finish
  • Pigment-based inks for full-color spectrum high-resolution printing
  • Durable 185gsm paper
  • Available in custom sizing up to 60”
  • Frames available on all standard sizes
  • Frames include Non-Glare Acrylic Glazing

About This Design

Caduceus Poster

Caduceus Poster

Design that makes caduceus motif

Customer Reviews

4.8 out of 5 stars rating14.2K Total Reviews
12227 total 5-star reviews1334 total 4-star reviews256 total 3-star reviews145 total 2-star reviews271 total 1-star reviews
14,233 Reviews
Reviews for similar products
5 out of 5 stars rating
By Sharon S.July 31, 2025Verified Purchase
Print, Size: 36.00" x 25.10", Media: Value Poster Paper (Semi-Gloss)
I was so amazed at how this all turned out. Everyone who attended the funeral was in awe of how beautiful it was made. And I owe it all to Zazzle. I wouldn’t have done it better myself not to mention I wouldnt have time to do it. The great part of it all was they had templates that was catered to my needs and that I could use it in ways I wanted to use to resize it my way. It took some time but I was happy it turned out great. I did 100 photos, 89, 66 photos (I think) lol templates. The only suggestion is that the templates, before sending through would tell you of errors like; saying please revise or resize it again for any photos that is not perfectly well sitting or not show it’s cutting off some of them and where it tells you there’s duplicates. Staring, placing and resizing all 100 + pictures into the template can be tiresome and overwhelming and it makes my eyes blurred that I can’t tell if they’re cutting off or overlapping or duplicates. Overall I am very pleased and will be using Zazzle again should the need arises. Thank you Zazzle. Altogether I’ve done 3 collages 1 profile picture and couple pictures with 1 frame and yet this is my first time ordering as a 1 time customer. Prices were very reasonable and accommodating to my finances. .
5 out of 5 stars rating
By Peyton C.November 8, 2023Verified Purchase
Print, Size: 8.00" x 10.00", Media: Value Poster Paper (Semi-Gloss)
Zazzle Reviewer Program
The sign was beautiful and matched our theme. The paper was good quality. Excellent printing!!
5 out of 5 stars rating
By Marianne O.November 26, 2021Verified Purchase
Print, Size: 12.00" x 12.00", Media: Value Poster Paper (Semi-Gloss)
Creator Review
Fun bright artwork that really captures the mood I’m going for! Pop art with cyberpunk energy. A little sweet but also spicy. This art is the perfect size and vibe for our art gallery wall. The printing looks great, high quality with vibrant colors! I went with the semi-gloss finish, which adds a little extra shine and thickness to the print making it excellent for high-traffic areas like the staircase wall.

Tags

Posters
caduceusmedicalsymbolmedicinegreekphysicianswandhermes
All Products
caduceusmedicalsymbolmedicinegreekphysicianswandhermes

Other Info

Product ID: 228598453171099113
Created on: 4/25/2010, 1:20 PM
Rating: G