Tap / click on image to see more RealViewsTM
Sale Price $28.69.  
Original Price $33.75 Comp. value
per mug
You save 15%

Caduceus Travel Mug

Qty:
Travel/Commuter Mug
-$14.80
-$13.70
-$12.70
-$9.60
-$8.60
-$5.25
Stainless Steel

Other designs from this category

About Mugs

Sold by

Style: Travel/Commuter Mug

You don’t have to give up a colorful, funny, or attractive design for the function of a top-notch travel mug. Zazzle’s commuter mugs feature a rubber-lined lid for a tight, spill-resistant seal, twist the lid to reveal the sip opening! So, take your favorite photo, monogram, pattern, or cool design with you on your new favorite mug.

  • Dimensions: 14-ounce: 2.5" D base x 3.5” D x 6.2” H
  • Materials: Stainless steel body; plastic handle and base; rubber-lined plastic lid
  • Double-walled stainless steel helps will keep your drink of choice hot
  • Do not microwave; hand wash recommended
  • Printed on demand in San Jose, California
  • Do not overfill and be careful with hot liquids that may scald
  • Keep out of reach of children when filled with hot liquid

About This Design

Caduceus Travel Mug

Caduceus Travel Mug

Design that makes caduceus motif

Customer Reviews

4.8 out of 5 stars rating21.9K Total Reviews
19375 total 5-star reviews1844 total 4-star reviews335 total 3-star reviews152 total 2-star reviews239 total 1-star reviews
21,945 Reviews
Reviews for similar products
5 out of 5 stars rating
By AnonymousAugust 31, 2025Verified Purchase
Travel/Commuter Mug, 15 oz
everything is still going great .
5 out of 5 stars rating
By Suzanne H.January 28, 2025Verified Purchase
Travel/Commuter Mug, 15 oz
Creator Review
My husband loves his custom personalized Bible verse travel mug, here’s a screenshot of his Facebook post he shared on social media.
5 out of 5 stars rating
By Faith I.January 5, 2016Verified Purchase
Travel/Commuter Mug, 15 oz
Creator Review
Impressive stainless steel quality. Purchased as Christmas gift for someone. They loved having their name on it! Will buy again. Next time for graduation gift. Very pleased with imaging-legible text, colors crisp

Tags

Mugs
caduceusmedicalsymbolmedicinegreekphysicianswandhermes
All Products
caduceusmedicalsymbolmedicinegreekphysicianswandhermes

Other Info

Product ID: 168682776586601869
Created on: 4/25/2010, 1:17 PM
Rating: G