Tap / click on image to see more RealViewsTM
Sale Price $15.77.  
Original Price $18.55 Comp. value
per hat
You save 15%

Caduceus Trucker Hat

Qty:
Foam Trucker Hat
+$5.15
+$12.30
+$11.10
+$12.30
+$11.10
+$22.95
+$18.20
White and Black

Other designs from this category

About Hats

Sold by

Style: Foam Trucker Hat

Looking to cheer your team, promote your brand, or simply keep the sun out of your eyes? Our custom hats are the perfect way to meet all these needs and more. Customize the front with a logo, design, or text and create an essential accessory that you will never leave behind!

  • Adjustable from 17" to 24"
  • 100% polyester foam front
  • Wide area to feature your design
  • 100% nylon mesh back keeps you cool
  • Available in 11 color combinations
Recommended for ages 6+

About This Design

Caduceus Trucker Hat

Caduceus Trucker Hat

Design that makes caduceus motif

Customer Reviews

4.7 out of 5 stars rating2.3K Total Reviews
1913 total 5-star reviews323 total 4-star reviews66 total 3-star reviews18 total 2-star reviews24 total 1-star reviews
2,344 Reviews
Reviews for similar products
5 out of 5 stars rating
By Homer R.May 27, 2020Verified Purchase
Custom Foam Trucker Hat, White and Black
Zazzle Reviewer Program
I’m very proud of this product and how it turned out ... ready to help promote my business/music ... and excited for customers to order more :). Printing is a success thanks so much ... makes me excited to see my future products arrive in the mail!!! Soon!
5 out of 5 stars rating
By zabihullah w.September 17, 2023Verified Purchase
Custom Foam Trucker Hat, White and Black
Zazzle Reviewer Program
really cheap for such high durable long lasting quality using different color inks. I think its because they mass produce for a lot of customers is why how they can deliver good lasting quality that is environmental friendly without compromising durability. was great. but light colors or light color letters on dark background has not been best looking unless if its white on black and not light blue on black.
5 out of 5 stars rating
By Johnny B.August 3, 2023Verified Purchase
Custom Foam Trucker Hat, White and White
Zazzle Reviewer Program
The hat came out awesome . I had a test run done of my clubs logo just to see how it would look. And it came out better than expected. We will be using this company moving forward. Thanks. Excellent hat and printing was above what i was expecting.

Tags

Hats
caduceusmedicalsymbolmedicinegreekphysicianswandhermes
All Products
caduceusmedicalsymbolmedicinegreekphysicianswandhermes

Other Info

Product ID: 148478503511291049
Created on: 4/26/2010, 7:24 AM
Rating: G