Tap / click on image to see more RealViewsTM
Sale Price $16.70.  
Original Price $18.55 Comp. value
per hat
You save 10%

Caduceus Trucker Hat

Qty:
Foam Trucker
+$5.15
+$12.30
+$11.10
+$12.30
+$11.10
+$22.95
+$18.20
White and Black

Other designs from this category

The Zazzle Promise

  • Order with Confidence

    If something goes wrong on our end, we'll make it right, on every order. Learn more!

  • FREE Shipping

    Enjoy FREE shipping with a 30-day free trial of Zazzle Plus – Learn More!

  • Secure Shopping Guaranteed

    100% Secure payment with SSL Encryption.

About Hats

Sold by

Style: Foam Trucker

Looking to cheer your team, promote your brand, or simply keep the sun out of your eyes? Our custom hats are the perfect way to meet all these needs and more. Customize the front with a logo, design, or text and create an essential accessory that you will never leave behind!

  • Adjustable from 17" to 24"
  • 100% polyester foam front
  • Wide area to feature your design
  • 100% nylon mesh back keeps you cool
  • Available in 11 color combinations
Recommended for ages 6+

About This Design

Caduceus Trucker Hat

Caduceus Trucker Hat

Design that makes caduceus motif

Customer Reviews

4.7 out of 5 stars rating2.4K Total Reviews
1932 total 5-star reviews323 total 4-star reviews68 total 3-star reviews22 total 2-star reviews25 total 1-star reviews
2,370 Reviews
Reviews for similar products
5.0 out of 5 stars rating
5 out of 5 stars rating
By carey j.May 29, 2026Verified Purchase
Custom Classic Bucket, Black
Love my company hats, shirts, and ID badge!! Just as I described!! And at a reasonable cost and on time!! Thank you Zazzel.
5.0 out of 5 stars rating
5 out of 5 stars rating
By Homer R.May 27, 2020Verified Purchase
Custom Foam Trucker, White and Black
Zazzle Reviewer Program
I’m very proud of this product and how it turned out ... ready to help promote my business/music ... and excited for customers to order more :). Printing is a success thanks so much ... makes me excited to see my future products arrive in the mail!!! Soon!
5.0 out of 5 stars rating
5 out of 5 stars rating
By zabihullah w.September 17, 2023Verified Purchase
Custom Foam Trucker, White and Black
Zazzle Reviewer Program
really cheap for such high durable long lasting quality using different color inks. I think its because they mass produce for a lot of customers is why how they can deliver good lasting quality that is environmental friendly without compromising durability. was great. but light colors or light color letters on dark background has not been best looking unless if its white on black and not light blue on black.

Tags

Hats
caduceusmedicalsymbolmedicinegreekphysicianswandhermes
All Products
caduceusmedicalsymbolmedicinegreekphysicianswandhermes

Other Info

Product ID: 148478503511291049
Created on: 4/26/2010, 7:24 AM
Rating: G