Shop Our Top Picks

New ArrivalsTop Deals
Today's Moment

Shop by Category

Shop All Categories

Accessories

Baby & Kids

Clothing & Shoes

Crafts & Party Supplies

Electronics

Home Décor

Invitations & Stationery

Office & School

Sports, Toys & Games

Wall Art & Décor

Weddings

Create Your Own

Shop All Products

Officially Licensed Brands

Customizable Designs From Brands You Love

Find the Perfect Gift

More Ways to Save

Shop the Sale

Calligraphy name Personalized Script  Initial   Wall Decal (Front)Calligraphy name Personalized Script  Initial   Wall Decal (Insitu 1)Calligraphy name Personalized Script  Initial   Wall Decal (Insitu 2)
Calligraphy name Personalized Script  Initial   Wall Decal

Calligraphy name Personalized Script Initial Wall Decal

4.3(6)
$41.35 Comp. value
i
$31.02
per wall decal
Save 25% with code SAVEBIGTODAY
View Product Details

Other designs from this category

About Wall Decals

Sold by

Print Process: Automatic Opaque Design: White Underbase

Art is printed on a transparent sheet of plastic, but white ink is printed beneath all art, making those areas opaque while also making colours vivid.

Shape: Custom Cut

Wall Decals can be easily applied, removed, and repositioned without leaving damage or a sticky residue. They can be used on walls or any other smooth surface like - Mirrors, Doors, Drawer Cabinets and more. Wall decals are perfect for branding, decoration and promotions. These decals are not designed to stick on rough or uneven surfaces such as stucco, cinder block, and brick.

  • Reusable design is safe for walls
  • Sticks to most smooth, flat surfaces
  • No tape or tacks required

About This Design

The glitter details are simulated in the artwork. No actual glitter will be used in the making of this product.

Calligraphy name Personalized Script Initial Wall Decal

The design is a photo and the cases are not made with actual glitter, sequins, metals or woods. This design is also available on other phone models. Choose Device Type to see other iPhone, Samsung Galaxy or Google cases. Some styles may be changed by selecting Style if that is an option. You may also transfer this design to another product. This design may be personalized in the area provided by changing the photo and/or text. Or it can be customized by choosing the click to customize further option and delete or change the color the background, add text, change the text color or style, or delete the text for an image only design. Contact me at colorflowcreations@gmail.com if you with to have this design on another product. See more of my creations or follow me at www.facebook.com/colorflowcreations, www.instagram.com/colorflowcreations, www.twitter.com/colorflowart, and www.pinterest.com/colorflowcreations.

Reviews

There are no reviews for this design yet. customer reviews for other designs.
Have you purchased this product?

Tags

Wall Decals
monogramnamestickerdecalwallscriptcalligraphyname wall decalcalligraphy namecustom wall decal
All Products

Other Info

Product ID: 256514934405245025
Created on: 8/23/2022, 9:12 AM
Rating: G