Tap / click on image to see more RealViewsTM
Sale Price $33.20.  
Original Price $39.05 Comp. value
per case
You save 15%

Celestial Starry Flying Pigs Monogrammed Case-Mate iPhone Case

Qty:
Barely There
+$5.55

Other designs from this category

About Zazzle Cases

Sold by

Style: Case-Mate Barely There Apple iPhone 15 Case

This form-fitting, featherlight Case-Mate custom case provides full coverage to your phone while still keeping your device ultra sleek and stylish.

  • Designed for the Apple iPhone 15
  • Slim profile and lightweight
  • Impact resistant, durable hard plastic
  • Case does not interfere with wireless charging
  • Lay-flat bezel to protect your screen from directly contacting surfaces
  • Access to all ports, controls & sensors
  • Customize with your images, designs, and text
  • Glossy finish
  • Printed in the USA

About This Design

Celestial Starry Flying Pigs Monogrammed Case-Mate iPhone Case

Celestial Starry Flying Pigs Monogrammed Case-Mate iPhone Case

Embrace whimsy with this adorable design featuring pink flying pigs against a celestial, starry night sky. The playful motif creates a magical and fun look, perfect for those who love unique and imaginative accessories. The monogram element adds a personalized and stylish touch, making this design both charming and functional. Ideal for adding a touch of fantasy and humor to your everyday items.

Customer Reviews

4.7 out of 5 stars rating6.5K Total Reviews
5219 total 5-star reviews839 total 4-star reviews208 total 3-star reviews115 total 2-star reviews117 total 1-star reviews
6,498 Reviews
Reviews for similar products
5 out of 5 stars rating
By Laurie G.February 14, 2024Verified Purchase
Case-Mate Phone Case, Apple iPhone 15, Barely There
Zazzle Reviewer Program
I order a phone case with a picture of my dog every time I get a new phone. I think the quality it great, and easy to fit on the phone and still use buttons. Everything about the design and quality is great, and I love it. The only thing I regret is that I zoomed in to the picture too much, and didn't realize it until I received the the phone case.
5 out of 5 stars rating
By Donna S.December 12, 2023Verified Purchase
Case-Mate Phone Case, Apple iPhone 15, Barely There
Creator Review
Very well made and it fit my iPhone perfectly! Turn out exactly how I wanted it. The colors were clear and very sharp.
5 out of 5 stars rating
By Lisa S.January 7, 2026Verified Purchase
Case-Mate Phone Case, Apple iPhone 14, Barely There
Nice case and the picture is exactly what I asked for.

Tags

Zazzle Cases
celestialstarsflying pigspiganimalwhimsicalfantasyquirkymonogramgift
All Products
celestialstarsflying pigspiganimalwhimsicalfantasyquirkymonogramgift

Other Info

Product ID: 256691017589660548
Created on: 6/3/2024, 3:43 AM
Rating: G