Tap / click on image to see more RealViewsTM
Sale Price $35.15.  
Original Price $39.05 Comp. value
per case
You save 10%

Celestial Starry Flying Pigs Monogrammed Case-Mate iPhone Case

Qty:
Barely There
+$5.55

Other designs from this category

About Zazzle Cases

Sold by

Style: Case-Mate Barely There Apple iPhone 15 Case

This form-fitting, featherlight Case-Mate custom case provides full coverage to your phone while still keeping your device ultra sleek and stylish.

  • Designed for the Apple iPhone 15
  • Slim profile and lightweight
  • Impact resistant, durable hard plastic
  • Case does not interfere with wireless charging
  • Lay-flat bezel to protect your screen from directly contacting surfaces
  • Access to all ports, controls & sensors
  • Customize with your images, designs, and text
  • Glossy finish
  • Printed in the USA

About This Design

Celestial Starry Flying Pigs Monogrammed Case-Mate iPhone Case

Celestial Starry Flying Pigs Monogrammed Case-Mate iPhone Case

Embrace whimsy with this adorable design featuring pink flying pigs against a celestial, starry night sky. The playful motif creates a magical and fun look, perfect for those who love unique and imaginative accessories. The monogram element adds a personalized and stylish touch, making this design both charming and functional. Ideal for adding a touch of fantasy and humor to your everyday items.

Customer Reviews

4.7 out of 5 stars rating6.5K Total Reviews
5234 total 5-star reviews838 total 4-star reviews211 total 3-star reviews118 total 2-star reviews123 total 1-star reviews
6,524 Reviews
Reviews for similar products
5.0 out of 5 stars rating
5 out of 5 stars rating
By Laurie G.February 14, 2024Verified Purchase
Case-Mate Phone Case, Apple iPhone 15, Barely There
Zazzle Reviewer Program
I order a phone case with a picture of my dog every time I get a new phone. I think the quality it great, and easy to fit on the phone and still use buttons. Everything about the design and quality is great, and I love it. The only thing I regret is that I zoomed in to the picture too much, and didn't realize it until I received the the phone case.
5.0 out of 5 stars rating
5 out of 5 stars rating
By Donna S.December 12, 2023Verified Purchase
Case-Mate Phone Case, Apple iPhone 17, Slim
Creator Review
Very well made and it fit my iPhone perfectly! Turn out exactly how I wanted it. The colors were clear and very sharp.
5.0 out of 5 stars rating
5 out of 5 stars rating
By Laura S.December 20, 2023Verified Purchase
Case-Mate Phone Case, Apple iPhone 6/6s, Barely There
Zazzle Reviewer Program
Put your logo on your phone! I've had it for years, thanks to Zazzle! I get so many comments positive about it, and if you ever lose your phone, the finder knows immediately who it belongs to! Clear and perfect! Attention getting for sure.

Tags

Zazzle Cases
celestialstarsflying pigspiganimalwhimsicalfantasyquirkymonogramgift
All Products
celestialstarsflying pigspiganimalwhimsicalfantasyquirkymonogramgift

Other Info

Product ID: 256691017589660548
Created on: 6/3/2024, 3:43 AM
Rating: G