Tap / click on image to see more RealViewsTM
Sale Price $1.07.  
Original Price $1.25 Comp. value
per sheet
You save 15%

Cherry Bridal Shower Recipe Card

Qty:

Other designs from this category

Shop this collection

Katsiaryna Lukyanava
Love is Cherry Sweet Bridal ShowerDesigned by Katsiaryna Lukyanava
Tap / click on image to see more RealViewsTM
 
 
 
 
 
 
 
 

About Paper Sheets

Sold by

Size: 4.5" x 5.6"

A flat sheet of paper has unlimited possibilities; from flyers to paper airplanes and everything in between, the world is your oyster! Go and conquer.

  • Dimensions: 4.5" L x 5.6" H (portrait); 5.6" L x 4.5" H (landscape)
  • High-quality, full-color, full-bleed printing
  • Print on both sides
  • Add personal photos and text for no additional upcharge
  • Please note that envelopes are optional
  • 100% satisfaction guarantee
  • Let us print for you! Select your desired quantity for any project big or small

Paper Type: Basic Semi-Gloss

Bright, crisp, and versatile—our Semi-Gloss paper delivers vibrant color and a smooth, polished finish, making it an ideal choice for your lightweight projects .

  • Made in Italy, printed in the USA
  • 50% recycled content

About This Design

Cherry Bridal Shower Recipe Card

Cherry Bridal Shower Recipe Card

This item designed to evoke a sense of anticipation and excitement, making guests feel cherished and honored to be part of such a special occasion. The whimsical cherry motif, paired with elegant watercolor artistry, creates a design that is as delightful and sweet as the love being celebrated. Each cherry is rendered with a soft touch, capturing the lush red of ripe fruit and paired with delicate green leaves that add a lively contrast. This watercolor cherry canvas adds depth and dimension, giving the items a hand-crafted feel that is both personal and unique. This item invites guests to step into a world of whimsical romance. Click on the “Customize it” button for further personalization of this template. You will be able to modify the style, colors, and sizes. Matching items available.

Customer Reviews

4.5 out of 5 stars rating103 Total Reviews
80 total 5-star reviews9 total 4-star reviews6 total 3-star reviews3 total 2-star reviews5 total 1-star reviews
103 Reviews
Reviews for similar products
5 out of 5 stars rating
By Dawn B.September 8, 2021Verified Purchase
Flat Paper Sheet, Size: 4.5" x 5.6", Paper: Basic Semi-Gloss, Envelopes: None
Zazzle Reviewer Program
Perfect addition to the wedding shower invites. Couldn't have been more pleased. Font was beautiful on the cards.
5 out of 5 stars rating
By Eileen P.January 28, 2025Verified Purchase
Flat Paper Sheet, Size: 4.5" x 5.6", Paper: Basic Semi-Gloss, Envelopes: None
I have ordered many items in this Wildflower/Bridal Tea Shower package and everything is so beautiful!
5 out of 5 stars rating
By Talitha D.April 18, 2017Verified Purchase
Flat Paper Sheet, Size: 8.5" x 11", Paper: Thin Matte Paper, Envelopes: None
Creator Review
These recipe card inserts were the perfect match to the "Cooking is an Art" recipe binder! I love how I was able to make an entire matching set and customize the whole order. Printing is exactly as shown here. Bright and vibrant!

Tags

Paper Sheets
recipe cardbridal showercherryrecipeskitchencalligraphyfruitminimalistwatercolorwedding shower
All Products
recipe cardbridal showercherryrecipeskitchencalligraphyfruitminimalistwatercolorwedding shower

Other Info

Product ID: 256238823566084360
Created on: 7/7/2024, 2:20 AM
Rating: G