Sell on Zazzle
Tap / click on image to see more RealViewsTM
Sale Price $18.24.  
Original Price $21.45 Comp. value
per shirt
You save 15%

Cherry Hearts Cute and Funny T-Shirt

4.5 out of 5 stars rating
14924 Total Reviews |
by
Qty:
Style
Basic T-Shirt
+$8.35
+$20.85
+$9.15
Color & Print Process
White
Classic Printing: No Underbase
Vivid Printing: White Underbase

Other designs from this category

About T-Shirts

Sold by
T-ShirtCreate your own from scratch

Style: Women's Basic T-Shirt

This basic t-shirt features a relaxed fit for the female shape. Made from 100% cotton, this t-shirt is both durable and soft - a great combination if you're looking for that casual wardrobe staple. Select a design from our marketplace or customize it and unleash your creativity!

Size & Fit

  • Model is 5’7” and is wearing a small
  • Standard fit
  • Fits true to size

Fabric & Care

  • 100% cotton
  • Double-needle hemmed sleeves and bottom
  • Machine wash cold
  • Imported

About This Design

Cherry Hearts Cute and Funny T-Shirt

Cherry Hearts Cute and Funny T-Shirt

Sweet, playful, and full of charm, this Cherry Hearts T‑shirt brings a fresh twist to classic Valentine style. Featuring a cute cherry motif paired with heart‑shaped accents, it’s perfect for anyone who loves fun, flirty designs with a touch of retro sweetness. Whether you’re dressing for Valentine’s Day, gifting someone special, or simply adding a little love‑themed flair to your everyday wardrobe, this tee delivers cheerful vibes and effortless style.
Cosmic Tornado
Artwork designed by
View their Store

Customer Reviews

4.5 out of 5 stars rating14.9K Total Reviews
10581 total 5-star reviews2865 total 4-star reviews832 total 3-star reviews389 total 2-star reviews257 total 1-star reviews
14,924 Reviews
Reviews for similar products
5.0 out of 5 stars rating
5 out of 5 stars rating
By eunice y.October 21, 2021 • Verified Purchase
Basic T-Shirt, White, Medium
Zazzle Reviewer Program
This Product Included Many Of My Immediate Family Members & We All Love The Excellent Quality Work Put Into Our T-Shirts & The Pricing!!! As Always Zazzle Does Excellent Quality Work On Everything We Have Ever Ordered Including Our Past Orders Our Beautiful Blankets!!
5.0 out of 5 stars rating
5 out of 5 stars rating
By Yuliya U.May 10, 2022 • Verified Purchase
Basic T-Shirt, Black, Small
Zazzle Reviewer Program
Perfect memorable good quality gift for any occasion. Colors turned out like expected I ordered black t-shirt with pink prints
5.0 out of 5 stars rating
5 out of 5 stars rating
By Lisa K.September 28, 2022 • Verified Purchase
Basic T-Shirt, White, Small
Creator Review
I bought each of my kids a t-shirt and they did not disappoint. I would probably buy them the black shirt next time or a better quality as my daughter loves her and has almost worn it out already. Printing is great. Could be a little darker but its cool.

Tags

T-Shirts
cherryheartfunkycutesweetvalentinegraphicflirtycherries
All Products
cherryheartfunkycutesweetvalentinegraphicflirtycherries

Other Info

Product ID: 256124709515819054
Created on: 2/6/2026, 12:27 PM
Rating: G