Tap / click on image to see more RealViewsTM
Sale Price $61.88.  
Original Price $72.80 Comp. value
per wall decal
You save 15%

Christmas Gifts Wall Sticker

Qty:
Single
Snowflake
Left

Other designs from this category

About Wall Decals

Sold by

Number of Shapes: Walls 360 Custom Wall Decal

Brighten up any room with a custom wall decal from Zazzle and Walls 360! Printed with premium eco-solvent inks on high quality fabric paper, your images, text, and designs will pop off the wall with stunning clarity and color accuracy. Made to be moved, each wall decal can be peeled and repeeled up to one hundred times without damaging the decal or walls. No glue, no frames, no pain – make a space all your own with a customized wall decal!

  • Brilliant high-resolution printing on self-adhesive fabric paper.
  • Easy peel and restick up to 100 times. No wall damage or sticky residue.
  • Manufactured by Walls 360 in Las Vegas, Nevada.
⚠️ WARNING! Choking hazard — Small parts; Not for children under 3 years.

About This Design

Christmas Gifts Wall Sticker

Christmas Gifts Wall Sticker

Christmas gift and Christmas tree on dark background

Customer Reviews

4.8 out of 5 stars rating133 Total Reviews
118 total 5-star reviews13 total 4-star reviews0 total 3-star reviews0 total 2-star reviews2 total 1-star reviews
133 Reviews
Reviews for similar products
5 out of 5 stars rating
By AnonymousApril 7, 2026Verified Purchase
12"x12" Square Wall Decal
Exactly as it looked online and is the perfect addition to my kitchen decor. I placed it on my stove with complementary pieces.
5 out of 5 stars rating
By Vivian D.April 10, 2021Verified Purchase
12"x18" Rectangle Wall Decal
Creator Review
This is my photo, that I've always loved, from my shop on Zazzle -- Vivian's Shop -- and I like to "try my products out". This is nothing short of spectacular over the door -- photo enclosed -- I am certain it will become a real conversation piece and I can enjoy it every day. Quality and colors are excellent. Quality and colors are excellent as hoped -- I had photoshop'd it previously to make the colors more vivid and they came out exactly as I would have wished -- my included photo may not entirely do it justice but I wanted to show the great positioning.
5 out of 5 stars rating
By Vivian D.April 10, 2021Verified Purchase
12"x12" Square Wall Decal
Creator Review
Love it!! I sort of "have a thing" for lighthouses and when I took this photo I wanted to do something special with it but was running out of wall space at home. This was perfect -- it is happily sitting on the side of a bookcase -- and it looks just great. The photo is from my shop at Zazzle -- Vivian's Shop -- and also part of my desire to "test drive" my products to ensure I am happy with them. I am certainly happy with this one! So many fun and interesting places to think of with these lovely wall art decals. Colors and graphics (I had also added a canvas "feel" to it) -- really came out exactly has hoped for. I hope the attached photo does it justice.

Tags

Wall Decals
christmasxmasholidaymerryyearnewhappytreegiftsgift
All Products
christmasxmasholidaymerryyearnewhappytreegiftsgift

Other Info

Product ID: 256382468411832242
Created on: 11/12/2012, 10:06 AM
Rating: G