Tap / click on image to see more RealViewsTM
Sale Price $14.40.  
Original Price $18.00. Comp. value
Sale Price $1.80per paper plate.
You save 20% ends today

Christmas Open House Paper Plates 9"

Qty:
9" Round Paper Plate
-$0.35
-$0.35

Other designs from this category

About Paper Plates

Sold by

Size and Style: 9" Round Paper Plate

Throw a spectacular party with fully customizable paper plates to match your theme! Each set of paper plates is printed on durable paper stock and decorated with your custom designs or photos. These plates are perfect for serving dinner, appetizers, or salads. Order these with our paper napkins for a complete set of party tableware that your guests will love!

  • Dimensions: 9" diameter
  • FDA compliant for food contact safety
  • Great for serving dinners, lunches, appetizers, or salads
  • Printed in USA

About This Design

Christmas Open House Paper Plates 9"

Christmas Open House Paper Plates 9"

Welcome, guests to your holiday home with a custom made a paper plate. Personalize this plate with your own words.***This graphic design was created from public domain illustrations that were layered onto the plate.

Customer Reviews

4.6 out of 5 stars rating1.3K Total Reviews
1064 total 5-star reviews98 total 4-star reviews39 total 3-star reviews37 total 2-star reviews55 total 1-star reviews
1,293 Reviews
Reviews for similar products
5 out of 5 stars rating
By Tracy F.November 6, 2021Verified Purchase
Paper Plates, 9" Round Paper Plate
Zazzle Reviewer Program
When I chose this theme for my friends baby shower I was thrilled to see that the plates were offered on Zazzled. I was even more thrilled when they arrived on time and we’re ABSOLUTELY PERFECT!!! And the quality of the plate was great as well! I was worried they’re be flimsy but they were nice and sturdy for our hot foods! Absolutely PERFECT! I couldn’t have been happier. Everyone was so impressed!
5 out of 5 stars rating
By Becky K.March 5, 2021Verified Purchase
Paper Plates, 9" Round Paper Plate
Zazzle Reviewer Program
My Marie Antoinette tea was a success due in part to the beautiful “China” paper plates by Zazzle. The ladies thought they were real! Zazzle is my go-to first whenever planning an event. They were just like the picture showed- deep rich colors
5 out of 5 stars rating
By Debra W.May 31, 2020Verified Purchase
Paper Plates, 9" Round Paper Plate
Zazzle Reviewer Program
I ordered personalized baby shower plates and I loved them and they were delivered on time they were personalized with thanks for showering our little peanut. The printing turned out good but edge of plates had like tears around the edges I would recommend them to any one having a baby shower or party

Tags

Paper Plates
holiday partyopen housesnowmanfamilyfriendschristmaspaper plate
All Products
holiday partyopen housesnowmanfamilyfriendschristmaspaper plate

Other Info

Product ID: 256495157307116895
Created on: 6/20/2017, 8:51 PM
Rating: G