Tap / click on image to see more RealViewsTM
Sale Price $13.36.  
Original Price $16.70 Comp. value
per placemat
You save 20%

Classic Plaid Tartan Pattern-Dark Navy & White Cloth Placemat

Qty:

Other designs from this category

About Placemats

Sold by

Style: Placemats 20" x 14"

Complete your dining table setting with custom place mats from Zazzle. These 100% woven cotton place mats are designed to complement any dining room theme.

  • Dimensions: 20" x 14"
  • 100% woven cotton
  • Printed in full color, with vibrant colors designed to pop
  • Fabric is made from natural fibers, which may result in some slight irregularities
  • Made in the USA
  • Dry or spot clean only

About This Design

Classic Plaid Tartan Pattern-Dark Navy & White Cloth Placemat

Classic Plaid Tartan Pattern-Dark Navy & White Cloth Placemat

This cloth placemat features a classic plaid tartan pattern with crisp, intersecting lines and perfectly balanced symmetry. The structured check design adds a touch of timeless charm to any table setting, from everyday meals to festive occasions. Its versatile, repeating grid motif works beautifully across a wide range of color palettes — from subtle neutrals to bold, high‑contrast combinations — making it an easy match for both modern and traditional décor styles

Customer Reviews

4.6 out of 5 stars rating172 Total Reviews
133 total 5-star reviews24 total 4-star reviews9 total 3-star reviews3 total 2-star reviews3 total 1-star reviews
172 Reviews
Reviews for similar products
5 out of 5 stars rating
By Joan B.October 31, 2017Verified Purchase
Placemats 20" x 14"
Zazzle Reviewer Program
I was having trouble finding the right combination of colors for my new dining table. I did an online search and these popped up. I knew immediately these were the perfect match for my space. I ordered immediately and watched every day for shipping info, then for delivery date. I got them today, and they surpass my expectations in every way. Great look as well as quality. Thank you Zazzle! Perfect.
4 out of 5 stars rating
By Diane W.November 28, 2019Verified Purchase
Placemats 20" x 14"
Zazzle Reviewer Program
I love the pattern, but it is much browner in person than the photo. Also after washing the back fabric shrinks more than the front fabric so the placemat is uneven. The printing is great except for the color which is much browner.
5 out of 5 stars rating
By Y.August 20, 2015Verified Purchase
Placemats 20" x 14"
Zazzle Reviewer Program
I ordered a set of table cloth place mats for my home both in tribute to my parents heritage as well my own. My father is from Trinidad and my mother and self are from Jamaica. I was pleasantly surprised at the attention to detail. Absolutely amazing!! Big Up to Dazzle!! Much respect to the designers!! One Love

Tags

Placemats
classicplaidplacemattartanpatterntabledecorgeometriccheckplacemattimelessplaidtablelinenmoderntraditionalplacematstructuredgridtabledecorversatilepatternplacematstatementplaidtableaccentsymmetricalcheckdesigndarknavywhiteplaidplacemat
All Products
classicplaidplacemattartanpatterntabledecorgeometriccheckplacemattimelessplaidtablelinenmoderntraditionalplacematstructuredgridtabledecorversatilepatternplacematstatementplaidtableaccentsymmetricalcheckdesigndarknavywhiteplaidplacemat

Other Info

Product ID: 256811574032646573
Created on: 9/8/2025, 8:44 PM
Rating: G