Tap / click on image to see more RealViewsTM
Sale Price $26.64.  
Original Price $29.60 Comp. value
per All-Over Print Apron
You save 10%

Classic Plaid Tartan Pattern-Navy & White Apron

Qty:
Black
Medium
-$3.90
+$2.55

Other designs from this category

About All-Over Print Aprons

Sold by

Size: All-Over Print Apron, Medium 26"x30"

Whether you are cooking at home, hosting a summer BBQ, or creating arts & crafts- do so in style with our fully customizable aprons! Made of a top quality polyester, our fully sublimation designs will definitely make a great impression on your guests. Available in 3 sizes for adults, young adults, children- basically everyone! Each size is adorned with a sublimated neck strap and adjustable waist string to ensure the best design results.

  • Dimensions: 30" length x 26" width
  • Waist String 34.5"
  • Material: 100% Polyester
  • Full Dye Sublimation
  • One Side Printing Available
  • Machine wash in cold water on gentle cycle with mild detergent. Do not bleach or iron. Line dry.

About This Design

Classic Plaid Tartan Pattern-Navy & White Apron

Classic Plaid Tartan Pattern-Navy & White Apron

This apron features a classic plaid tartan pattern with crisp, intersecting lines and perfectly balanced symmetry. The structured check design blends heritage charm with modern versatility, making it a stylish and functional choice for cooking, baking, crafting, or hosting. Its repeating grid motif adapts beautifully to any color palette — from understated neutrals to bold, high‑contrast combinations — ensuring it complements a wide range of personal styles and kitchen décor

Customer Reviews

4.7 out of 5 stars rating644 Total Reviews
562 total 5-star reviews41 total 4-star reviews5 total 3-star reviews8 total 2-star reviews28 total 1-star reviews
644 Reviews
Reviews for similar products
5.0 out of 5 stars rating
5 out of 5 stars rating
By Gravityx9 D.November 14, 2022Verified Purchase
All-Over Print Apron, Medium
Creator Review
Great color and even though I ordered the kid size, it covers well enough to use during the holidays. I am not a big woman and prefer a shorter apron. I stand 5"6" and the length of the garment goes to mid-thigh. The tie straps fit well at my waist and even though there is no neck strap adjustment, the opening is plenty big enough. I am happy with the size and fit. I am sharing my apron with my 10 year old grandson, too! The color is vibrant and looks good, as shown on the website. The stitching looks strong and reinforced. Photographed is front side and back side of the apron, reinforced straps and coloring. My phone camera may not be the best at showing the details.
5.0 out of 5 stars rating
5 out of 5 stars rating
By Christie H.July 16, 2021Verified Purchase
All-Over Print Apron, Medium
Zazzle Reviewer Program
I was looking for a very specific gift and was so excited to actually find exactly what I was looking for! Quality is fantastic- water resistant fabric which looks easy to wash/keep clean, bright colors. I am so excited to give this to my pups’ groomer 💗. Design and lettering are perfect, very professional.
5.0 out of 5 stars rating
5 out of 5 stars rating
By Susan R.July 1, 2025Verified Purchase
All-Over Print Apron, Small
My granddaughter won a ribbon on her Hibiscus painting, so when we sat down to customize an apron-she chose that photo. She is enjoying her personalized apron & has created a cookbook with the same design. Grammy Camp was a huge success. Could not have been more pleased-we have memories to cherish. Thank You Zazzle!

Tags

All-Over Print Aprons
classicplaidaprontartanpatternaprongeometriccheckaprontimelessplaidhomedecormoderntraditionalapronstructuredgridpatternversatilepatternapronstatementplaidapronsymmetricalcheckdesignnavywhiteplaidapron
All Products
classicplaidaprontartanpatternaprongeometriccheckaprontimelessplaidhomedecormoderntraditionalapronstructuredgridpatternversatilepatternapronstatementplaidapronsymmetricalcheckdesignnavywhiteplaidapron

Other Info

Product ID: 256443526394758011
Created on: 9/12/2025, 5:24 PM
Rating: G