Tap / click on image to see more RealViewsTM
Sale Price $30.69.  
Original Price $36.10 Comp. value
per pillow
You save 15%

Classic Plaid Tartan Pattern-Navy & White Throw Pillow

Qty:
Throw Pillow 16" x 16"
+$6.65
+$17.85

Other designs from this category

About Pillows

Sold by

Size: Throw Pillow 16" x 16"

Accent your home with custom pillows from Zazzle and make yourself the envy of the neighborhood. Made from high-quality Simplex knit fabric, these 100% polyester pillows are soft and wrinkle-free. The heavyweight stretch material provides beautiful color definition for your design while also being the perfect complement to your couch!

  • Dimensions: 16" x 16" (square)
  • Simplex knit fabric; 100% polyester; wrinkle-free
  • Hidden zipper enclosure; synthetic-filled insert included
  • Machine washable
  • Made in the USA
Designer Tip: To ensure the highest quality print, please note that this product’s customizable design area measures 16" x 16". For best results please add 0.59" bleed.

About This Design

Classic Plaid Tartan Pattern-Navy & White Throw Pillow

Classic Plaid Tartan Pattern-Navy & White Throw Pillow

This throw pillow features a classic plaid tartan pattern with crisp, intersecting lines and perfectly balanced symmetry. The structured check design adds a timeless, heritage‑inspired touch that works beautifully in both modern and traditional interiors. Its versatile, repeating grid motif adapts effortlessly to any color palette — from soft neutrals to bold, high‑contrast combinations — making it an easy accent for sofas, beds, chairs, or cozy reading nooks

Customer Reviews

4.8 out of 5 stars rating7.2K Total Reviews
6189 total 5-star reviews699 total 4-star reviews149 total 3-star reviews59 total 2-star reviews67 total 1-star reviews
7,163 Reviews
Reviews for similar products
5 out of 5 stars rating
By M.December 10, 2021Verified Purchase
Throw Pillow, Throw Pillow 16" x 16"
Zazzle Reviewer Program
Fabric is very nice and of good quality. I like that there are many colors to choose from and you can have a different color on the back side if you choose.The pillow was to be 16" x 16" but ran a bit small. (14.5") Still happy just recommend you get a larger size . Design came out great. Colors were vivid and the overall quality is quite nice. Will definately order again. Highly recommend because it not only shipped super fast but overall I love the results!
5 out of 5 stars rating
By Heather S.September 7, 2020Verified Purchase
Throw Pillow, Throw Pillow 16" x 16"
Zazzle Reviewer Program
I wanted something special for my daughter. I made this for my baby and she will have this in her crib when she is born. It was not pixelated. The picture was very very clear.0
5 out of 5 stars rating
By Debbie G.July 14, 2021Verified Purchase
Throw Pillow, Throw Pillow 16" x 16"
Creator Review
This pillow has a striking design that comes from an original piece of art by artist Debbie Gibbs to celebrate the intersection of identities. It makes a unique gift for anyone wishing to message equality, inclusion, equity and justice. Placed just so in an office or home, it makes a strong statement. We love i on our covered patio/outdoor kitchen. It is holding up very well outside. Outstanding print quality!

Tags

Pillows
classicplaidthrowpillowtartanpatternpillowcovergeometriccheckpillowtimelessplaidhomedecormoderntraditionalpillowstructuredgridpatternversatilepatternpillowstatementplaidcushionsymmetricalcheckdesignnavywhiteplaidthrowpillow
All Products
classicplaidthrowpillowtartanpatternpillowcovergeometriccheckpillowtimelessplaidhomedecormoderntraditionalpillowstructuredgridpatternversatilepatternpillowstatementplaidcushionsymmetricalcheckdesignnavywhiteplaidthrowpillow

Other Info

Product ID: 256005583188580567
Created on: 9/9/2025, 4:48 AM
Rating: G