Tap / click on image to see more RealViewsTM
Sale Price $8.40.  
Original Price $10.50 Comp. value
per sticker
You save 20%

Cool Black Kitty Cats Meow Meow Vinyl Sticker Set

Qty:

Other designs from this category

About Custom-Cut Vinyl Stickers

Sold by

Sticker Sheet Size: Large 8" x 8" Sheet

Contour kiss-cut vinyl stickers have never been this custom before! Now you can design your own personalized stickers and we’ll use our patented laser kiss-cut technology perfectly around them for you, die-cut style! You can add a single design to create one perfect sticker, or add multiple different designs to a sheet and create a sheet of stickers, each beautifully printed and individually kiss-cut. Zazzle’s custom kiss-cut stickers allow you to create and make your unique style really stick!

  • Sheet Dimensions: 8" L x 8.5" H
  • Design Area: 8" L x 8" H
  • Stickers are cut to the exact shape of your image on a vinyl sheet
  • Removable, low-tack adhesive leaves no sticky residue
  • Choice between matte white, glossy white, or glossy transparent vinyl
  • Printed with solvent inks that are fade-proof, water-proof, and scratch-resistant
  • Available in 6 sizes
  • 0.125" border will be added around each sticker to protect your design and also help it stand out against any background
⚠️ WARNING! Choking hazard — Small parts; Not for children under 3 years.

About This Design

Cool Black Kitty Cats Meow Meow Vinyl Sticker Set

Cool Black Kitty Cats Meow Meow Vinyl Sticker Set

An assortment of fancy black cats. Longhaired black cat walking, black kitty looking over shoulder with long fluffy tail, and small shorthaired black cat. These fun feline vinyl decals are waterproof and scratch resistant. Great for laptops, water bottles, cell phones and car windows. These waterproof vinyl stickers make a purrrfect gift for black cat lovers! Visit Jenn's Doodle World for even more pet lover’s stickers and gifts featuring these cool cats.

Customer Reviews

4.7 out of 5 stars rating53 Total Reviews
47 total 5-star reviews2 total 4-star reviews1 total 3-star reviews1 total 2-star reviews2 total 1-star reviews
53 Reviews
Reviews for similar products
5 out of 5 stars rating
By Mindy B.November 12, 2019Verified Purchase
Medium 6" x 6" Sheet Custom-Cut Vinyl Stickers, Matte White
Zazzle Reviewer Program
I bought these decals for my daughter - she's personalized just about every water bottle she owns, so I thought it would be fun to add some acro love to the mix. They look great, and have held up in the dishwasher and through hand washing. The decal quality is great. The colors are rich and vibrant. There's a perfect border on each decal, too.
5 out of 5 stars rating
By J.October 24, 2022Verified Purchase
Extra-Large 14" x 14" Sheet Custom-Cut Vinyl Stickers, Matte White
Zazzle Reviewer Program
This is a great product. The design is beautiful, and it went on so easily to my laptop. I love it. I have had so many compliments. It is bright and really shows off the design. The printing was great. It looks just like the picture that I ordered from. Nice and bright.
5 out of 5 stars rating
By Tellurian T.March 5, 2022Verified Purchase
Extra-Small 3" x 3" Sheet Custom-Cut Vinyl Stickers, Glossy Transparent
Zazzle Reviewer Program
Just the right colors and proportions to liven up a dull black phone case. I tried a version on transparent vinyl, but it didn't stand out enough. This version works well. Good color and accurate circle with this version; an earlier version was imperfectly cut, leaving a straight edge.

Tags

Custom-Cut Vinyl Stickers
catblack catkittyanimalfelinewhiskerscat loveranimal lovercoolcat person
All Products
catblack catkittyanimalfelinewhiskerscat loveranimal lovercoolcat person

Other Info

Product ID: 256971941096641114
Created on: 3/6/2019, 1:33 PM
Rating: G