Tap / click on image to see more RealViewsTM
Sale Price $1.70.  
Original Price $2.42 Comp. value
per card
You save 30%

Custom Enchanted Daisy Baby Shower Thank You Card

Collection
Qty:

Envelopes

Squared
+$0.20
Signature Matte
18 pt thickness / 120 lb weight Soft white, soft eggshell texture
+$0.63
+$0.63
+$0.63
-$0.17

Other designs from this category

Shop this collection

Dylan Ashlay Ramjee
Magical Cute Daisy Baby ShowerDesigned by Dylan Ashlay Ramjee
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 

About Flat Thank You Cards

Sold by

Size: 3.5" x 5"

For all the ways you say thank you, we've got a custom thank you card just for you.

  • Dimensions: 3.5" L x 5" H (portrait); 5" L x 3.5" H (landscape)
  • High quality, full-color, full-bleed printing on both sides
  • Add personal photos and text for no additional upcharge

Paper Type: Signature Matte

Our Signature Matte paper is a customer favorite—smooth to the touch with a soft eggshell texture that elevates any design. Its sturdy 18 pt weight and natural feel make it the ideal choice for timeless, sophisticated events.

  • Exclusively made for Zazzle
  • Made and Printed in the USA
  • FSC® Certified—sourced from responsibly managed forests that protect both people and planet

About This Design

Custom Enchanted Daisy Baby Shower Thank You Card

Custom Enchanted Daisy Baby Shower Thank You Card

Express your gratitude with our "Custom Enchanted Daisy Baby Shower" thank you cards. These beautifully designed cards feature a sweet pastel daisy motif, making them a lovely way to show your appreciation. Customize the cards with your own heartfelt message, letting your guests know how much their presence meant to you. These thank you cards are the perfect finishing touch to your baby shower, allowing you to express your thanks in a personal and charming way. Your guests will cherish the thoughtful gesture and the beautiful design.

Customer Reviews

4.8 out of 5 stars rating3.6K Total Reviews
3189 total 5-star reviews261 total 4-star reviews62 total 3-star reviews29 total 2-star reviews103 total 1-star reviews
3,644 Reviews
Reviews for similar products
5 out of 5 stars rating
By Larissa C.January 3, 2022Verified Purchase
Flat Thank You Card, Size: 3.5" x 5", Paper: Signature Matte, Corner: Squared, Print Quality: Standard, Envelopes: White
Zazzle Reviewer Program
We were married the weekend before Thanksgiving. Our ceremony was private with just our immediate family members. Our reception was just a small cocktail party later that night with 30 of our close friends. These thank you cards allowed us to share with our guests a glimpse into the ceremony from that morning. I love that I was able to add in multiple pictures. The prints look great. I choose the Matte finish and if I were to do any type of card that has actual photos I would go with a glossy finish to enhance the picture.
4 out of 5 stars rating
By Kristy V.February 17, 2023Verified Purchase
Flat Thank You Card, Size: 3.5" x 5", Paper: Signature Matte, Corner: Squared, Print Quality: Standard, Envelopes: White
Zazzle Reviewer Program
This is the perfect size for my nails. I like that we are able to customize the front and back of the card, and the thickness is just right. It actually arrived faster than I expected it to. The only reason why I didn't give it 5 stars is because the first and last sheet was kind of damaged in the process of it getting here (and every card counts for a small business). The corners and sides are a little rigid, and there was a small stain on one of them, but the good thing was that it was only the front and back cards. I would say, maybe trying a different packaging type, or put the cards in a box of some sort so they don't get damaged.
5 out of 5 stars rating
By A.December 18, 2018Verified Purchase
Flat Thank You Card, Size: 3.5" x 5", Paper: Signature Matte, Corner: Squared, Print Quality: Standard, Envelopes: White
Zazzle Reviewer Program
I designed Christmas card by myself for the first time. And It's just exactly same as I expected, except the size. I chose 3.5*5 and it's quite smaller than I thought, but it's okay. The edit program for uploading was really easy and helpful! Just I wish there're more color options and metallic effect for text. Same as you can see on the screen!

Tags

Flat Thank You Cards
watercolordaisydaisy baby showerfloral baby showerwhite daisywhimsicalmagicalpastelsimpleflowers
All Products
watercolordaisydaisy baby showerfloral baby showerwhite daisywhimsicalmagicalpastelsimpleflowers

Other Info

Product ID: 256515102053315731
Created on: 6/16/2024, 3:06 AM
Rating: G