Sell on Zazzle
Tap / click on image to see more RealViewsTM
Sale Price $11.65.  
Original Price $13.70 Comp. value
per sticker
You save 15%

"Custom Vinyl Stickers: Design, Cut, and Apply! Sticker

4.5 out of 5 stars rating
1083 Total Reviews |
by
Qty:
Sticker Sheet Size
Media

Other designs from this category

About Custom-Cut Vinyl Stickers

Sold by
Custom-Cut Vinyl Sticker
Create your own from scratch

Sticker Sheet Size: Large 8" x 8" Sheet

Contour kiss-cut vinyl stickers have never been this custom before! Now you can design your own personalized stickers and we’ll use our patented laser kiss-cut technology perfectly around them for you, die-cut style! You can add a single design to create one perfect sticker, or add multiple different designs to a sheet and create a sheet of stickers, each beautifully printed and individually kiss-cut. Zazzle’s custom kiss-cut stickers allow you to create and make your unique style really stick!

  • Sheet Dimensions: 8" L x 8.5" H
  • Design Area: 8" L x 8" H
  • Stickers are cut to the exact shape of your image on a vinyl sheet
  • Removable, low-tack adhesive leaves no sticky residue
  • Choice between matte white, glossy white, or glossy transparent vinyl
  • Printed with solvent inks that are fade-proof, water-proof, and scratch-resistant
  • Available in 6 sizes
  • 0.125" border will be added around each sticker to protect your design and also help it stand out against any background
⚠️ WARNING! Choking hazard — Small parts; Not for children under 3 years.

About This Design

"Custom Vinyl Stickers: Design, Cut, and Apply! Sticker

"Custom Vinyl Stickers: Design, Cut, and Apply! Sticker

"Learn how to design and create your own custom-cut vinyl stickers at home! In this video, we'll guide you through the entire process, from choosing the right design to cutting and applying your stickers. Whether you're a beginner or a seasoned DIY enthusiast, you'll find helpful tips and tricks to make the perfect stickers for any project. Don't forget to like, comment, and subscribe for more creative tutorials!"
Class_Fashion_Store
Artwork designed by
gorakhour, Uttar Pradesh, India
View their Store

Customer Reviews

4.5 out of 5 stars rating1.1K Total Reviews
886 total 5-star reviews64 total 4-star reviews27 total 3-star reviews27 total 2-star reviews79 total 1-star reviews
1,083 Reviews
Reviews for similar products
5 out of 5 stars rating
By Aurelia T.May 5, 2022 • Verified Purchase
Extra-Large 14" x 14" Sheet Custom-Cut Vinyl Stickers, Matte White
Zazzle Reviewer Program
I was able to give us a designer the dimensions of my mini shot glasses and she was able to reduce all the labels onto one sheet we’re all I did was going to change the names and add the table number for my seating chart absolutely perfect. Simple perfect easy to read fit great on my jar
5 out of 5 stars rating
By Nichole M.August 9, 2020 • Verified Purchase
Large 8" x 8" Sheet Custom-Cut Vinyl Stickers, Matte White
Zazzle Reviewer Program
These turned out so beautifully and all our guests loved them!! They did not have the orange suit sleeves so I ordered them separately and they fit perfectly into the mailing envelope. I had an issue with the address labels not being ledge able and they redid them and replaced them. They are perfect!
3 out of 5 stars rating
By Ella K.June 5, 2025 • Verified Purchase
Medium 6" x 6" Sheet Custom-Cut Vinyl Stickers, Glossy Transparent
The design came in perfect! Very happy with that but every sticker started ripping at the edges because they were not cut around properly to peel .

Tags

Custom-Cut Vinyl Stickers
customstickersvinylstickersdiystickerscraftingstickerdesigncricutdiyprojectsvinylcuttingcrafttutorialsstickerart
All Products
customstickersvinylstickersdiystickerscraftingstickerdesigncricutdiyprojectsvinylcuttingcrafttutorialsstickerart

Other Info

Product ID: 256113934541291229
Created on: 8/26/2024, 1:45 AM
Rating: G 
Related Searches
vinyl stickersclear vinyl stickersgraphic design stickerssticker with name partyremovable waterproof vinyl decal stickersvinyl record stickerdie cut stickershomemade stickerscutout stickerprofessional stickers