Tap / click on image to see more RealViewsTM
Sale Price $25.76.  
Original Price $30.30 Comp. value
per money clip
You save 15%

Cute Elegant Pink Money Clip

Qty:
Silver Plated

Other designs from this category

About Money Clips

Sold by

Style: Money Clip

Wish a loved one good fortune with a personalized money clip! Made of brass and plated with premium rhodium, these custom money clips are available in 3 finishes and make for a perfect gift for Father's day, birthdays and more.

  • Dimensions: 1.96”l x 0.98”w x 0.19”h
  • Premium finish rhodium plating over brass body
  • Choice of 3 finishes: silver, gold, gunmetal
  • High-shine resin dome over design area for a refined, glossy look

About This Design

Cute Elegant Pink Money Clip

Cute Elegant Pink Money Clip

Elevate a practical accessory into a keepsake of elegance with this Pink Coquette Bow Money Clip. Its chic blush-tone bow motif evokes the playful yet refined coquette aesthetic, making even the simplest gesture—like retrieving your cash—feel charming. Customize it with your name in graceful calligraphy script to add a truly personal touch that transforms it from everyday tool into a heartfelt gift.

Customer Reviews

4.4 out of 5 stars rating69 Total Reviews
50 total 5-star reviews7 total 4-star reviews4 total 3-star reviews3 total 2-star reviews5 total 1-star reviews
69 Reviews
Reviews for similar products
5 out of 5 stars rating
By DAVID W.February 20, 2024Verified Purchase
Money Clip, Silver Plated
Zazzle Reviewer Program
Holds money bills securely. Outstanding imagery reproduction
5 out of 5 stars rating
By Diane A.December 5, 2020Verified Purchase
Money Clip, Gunmetal Plated
Creator Review
I like to keep my big bills separated product very good for me! Printing looks good happy with the money clip would buy more!
5 out of 5 stars rating
By Charles B.November 9, 2025Verified Purchase
Money Clip, Gold Plated
Great product and wonderful service .

Tags

Money Clips
pink bowcoquettecutegirlyfeminineelegantprettysweetgifts under fifty dollarscute personalized gift for girls
All Products
pink bowcoquettecutegirlyfeminineelegantprettysweetgifts under fifty dollarscute personalized gift for girls

Other Info

Product ID: 256069903224907387
Created on: 8/21/2025, 12:20 AM
Rating: G