Tap / click on image to see more RealViewsTM
Sale Price $27.27.  
Original Price $30.30 Comp. value
per money clip
You save 10%

Cute Elegant Pink Money Clip

Qty:
Silver Plated

Other designs from this category

About Money Clips

Sold by

Style: Money Clip

Wish a loved one good fortune with a personalized money clip! Made of brass and plated with premium rhodium, these custom money clips are available in 3 finishes and make for a perfect gift for Father's day, birthdays and more.

  • Dimensions: 1.96”l x 0.98”w x 0.19”h
  • Premium finish rhodium plating over brass body
  • Choice of 3 finishes: silver, gold, gunmetal
  • High-shine resin dome over design area for a refined, glossy look

About This Design

Cute Elegant Pink Money Clip

Cute Elegant Pink Money Clip

Elevate a practical accessory into a keepsake of elegance with this Pink Coquette Bow Money Clip. Its chic blush-tone bow motif evokes the playful yet refined coquette aesthetic, making even the simplest gesture—like retrieving your cash—feel charming. Customize it with your name in graceful calligraphy script to add a truly personal touch that transforms it from everyday tool into a heartfelt gift.

Customer Reviews

4.3 out of 5 stars rating70 Total Reviews
50 total 5-star reviews7 total 4-star reviews4 total 3-star reviews4 total 2-star reviews5 total 1-star reviews
70 Reviews
Reviews for similar products
5 out of 5 stars rating
By DAVID W.February 20, 2024Verified Purchase
Money Clip, Silver Plated
Zazzle Reviewer Program
Holds money bills securely. Outstanding imagery reproduction
5 out of 5 stars rating
By Diane A.December 5, 2020Verified Purchase
Money Clip, Gunmetal Plated
Creator Review
I like to keep my big bills separated product very good for me! Printing looks good happy with the money clip would buy more!
2 out of 5 stars rating
By AnonymousMarch 29, 2026Verified Purchase
Money Clip, Gold Plated
If you expecting an actual gold metal background, it's not. It looks like paper or at the very best it's some sort of plastic. It's cheap looking. I'm too embarrassed to give this as a gift. The picture I took makes it look better than it is. I don't think this will wear well either. I guess you get what you pay for. I'm very disappointed. .

Tags

Money Clips
pink bowcoquettecutegirlyfeminineelegantprettysweetgifts under fifty dollarscute personalized gift for girls
All Products
pink bowcoquettecutegirlyfeminineelegantprettysweetgifts under fifty dollarscute personalized gift for girls

Other Info

Product ID: 256069903224907387
Created on: 8/21/2025, 12:20 AM
Rating: G