Tap / click on image to see more RealViewsTM
Sale Price $1.38.  
Original Price $2.76 Comp. value
per card
You save 50%

Cute Girly Princess Crown Pink Photo Watercolor Invitation

Qty:
Choose Your Format

Envelopes

Choose from blank envelopes or save time with addressable envelopes

Squared
+$0.20
+$0.25
+$0.25
+$0.25
+$0.25
Signature Matte
Overall Pick
18 pt thickness / 120 lb weight Soft white, soft eggshell texture
+$1.44
+$0.59
+$0.59
-$0.16
+$0.59

Other designs from this category

Shop this collection

Ioana Nedelcu
PRINCESS BIRTHDAYDesigned by Ioana Nedelcu
Tap / click on image to see more RealViewsTM
 
 
 
 
 
 
 
 

About Invitations

Sold by

Size: 5" x 7"

Make custom invitations and announcements for every special occasion! Choose from twelve unique paper types, two printing options, and six shape options to design a card that's perfect for you.

  • Dimensions: 5" x 7" (portrait or landscape)
  • Standard white envelope included
  • High quality, full-color, full-bleed
  • Add photos and text to both sides of this flat card at no extra charge
  • Two printing options available: Standard and High-Definition
  • 12 unique paper types and colors to choose from
  • Designer Tip: To ensure the highest quality print, please note that this product’s customizable design area measures 5" x 7". For best results please add 1/16" bleed.

Paper Type: Signature Matte

Our Signature Matte paper is a customer favorite—smooth to the touch with a soft eggshell texture that elevates any design. Its sturdy 18 pt weight and natural feel make it the ideal choice for timeless, sophisticated events.

  • Exclusively made for Zazzle
  • Made and Printed in the USA
  • FSC® Certified—sourced from responsibly managed forests that protect both people and planet

About This Design

Cute Girly Princess Crown Pink Photo Watercolor   Invitation

Cute Girly Princess Crown Pink Photo Watercolor Invitation

This cute modern Princess invitation is perfect for your daughter's royal birthday bash. This enchanting design features a delicate white crown motif and Cinderella's magical essence, set against a vibrant pink backdrop, exuding grace and sophistication. The minimalist crown adds a regal touch, accompanied by classic black and white text for clarity and style. Celebrate your little princess in a whimsical manner with this customizable invitation, where you can include her name in beautiful handwriting. Elevate the magic further by adding a customizable photo of your princess. Available in both print and digital download formats, it's the ultimate choice for a memorable celebration.

Customer Reviews

4.8 out of 5 stars rating68.4K Total Reviews
60624 total 5-star reviews5613 total 4-star reviews986 total 3-star reviews460 total 2-star reviews704 total 1-star reviews
68,387 Reviews
Reviews for similar products
5 out of 5 stars rating
By Margaret O.September 22, 2021Verified Purchase
Flat Invitation, Size: 5" x 7", Paper: Signature Matte, Corner: Squared, Envelopes: White, Print Quality: Standard
Zazzle Reviewer Program
After cruising the Internet for weeks for an invitation to an 85th birthday party for a life-long car enthusiast, we landed at Zazzle. All our guests raved about the invitation: a racy exotic car that said it all and helped set the theme for the event. Who ever knows what to expect when ordering online from a new company? The high caliber of the card stock and print job were a great relief. Moreover, the order was executed quickly and efficiently. We were so pleased that we used Zazzle soon after for another print job.
5 out of 5 stars rating
By Carmia J.October 27, 2023Verified Purchase
Flat Invitation, Size: 5" x 7", Paper: Signature Matte, Corner: Squared, Envelopes: White, Print Quality: Standard
Creator Review
It's a beautiful, bright, eye-catching design. The pool water looks very realistic. The card is nice and thick and it feels soft to touch. The colors are beautiful. The printing came out perfectly.
5 out of 5 stars rating
By Marilyn P.December 11, 2024Verified Purchase
Flat Invitation, Size: 5" x 7", Paper: Signature Matte, Corner: Squared, Envelopes: White, Print Quality: Standard
Soooo much beautiful, we are in love with this cards. At the beginning it was an invitation but I modified for A Save the Date and it was amazing. Thank you Zazzle.

Frequently Asked Questions:

Having your Cute Girly Princess Crown Pink Photo Watercolor Invitation match the theme of your party is a great detail that your guests will appreciate. The thoughtfulness of a consistent party theme is often appreciated and can show your guests that you can host a cohesive event.

The best time to send out invitations is typically 2-3 months before the event for small or medium sized events. For example, you’d want to send out your holiday party invitations 2-3 months ahead of time. You’ll want to order your invitations about 2 weeks before you send them out, so the best time to order your invitations from us is about 2.5-3.5 months ahead of time. This allows your guests to plan accordingly and helps to maximize the chance that a guest can come.

For large events like weddings, you’ll want to give your invitees more notice than for standard events. Order your wedding invitations and envelopes about 4.5-6.5 months in advance to send your invitations 4-6 months before the special day.

High-definition printing is great for pictures that you want to pop and dial up the vibrancy with a high-definition digital printing process. We use CMYK inks plus a lighter shade of cyan and magenta, so we’re able to generate a broader range of colors to more accurately represent the real-life behind your photos. Skin tones and pastel colors have never looked better with high-definition printing. Your images will be brighter, more precise, and livelier.

While you can customize any existing design by going to a product page and selecting "Personalize" then "Edit using Design Tool," you can also create your own design completely from scratch through the following:

  • Step 1: Navigate to our "Personalized Custom Invitations & Announcement" page
  • Step 2: Find the product you want to add a design to and click on it to get to a page that features that product
  • Step 3: Select "Customize This Design"
  • Step 4: You’ll then enter our design tool, which you can use to add text, images, and more to completely customize your design

Yes, our papers are not only recyclable but eco-friendly, and select papers are made with recycled content. We sourced, sampled, and carefully selected each paper offered in our three collections.

There are a number of paper types available to choose from in our paper collection. Our core paper types include Basic Semi-Gloss, Signature Matte, Signature Double-Thick, Premium Linen, Premium Pearlescent, and Premium Soft Touch. We only offer the highest quality paper options for our products.

We have hundreds if not thousands of different invitation designs like Princess Birthday Invitations and Pink Birthday Invitations. However, if none of these designs match your needs you can customize any existing design or make your own from scratch so that you can set the stage for a memorable celebration.

We absolutely do! We have a wide variety of supplies that you can purchase to match your Cute Girly Princess Crown Pink Photo Watercolor Invitation.

For example, you can browse our cards and posters. In the rare case where customers can’t find what they need, you can customize any design or talk to our customer support to better help you host your dream event.

If you’re looking for a personalized way to close your envelopes check out our envelope seals or our wax seals to make your invitations really stand out. You can also use existing or personalized rubber stamp designs to go along with the theme of your invitations. We have thousands of products and designs for your event to get your guests pumped up for the festivities.

You can pick to download your custom Cute Girly Princess Crown Pink Photo Watercolor Invitation in any of the following 4 file types: PNG, JPG, Standard PDF, and Print PDF. These 4 file formats have been selected so they cover all your inviting needs. PNG and JPG are great for sending your invitations online. All of these file formats are great if you want to print your invitations yourself. However, having unlimited downloads allows you to download all four formats for maximum versatility. You can even apply your digital download design to other popular products on Zazzle.

It’s easy! Personalize, download & share in minutes rather than weeks. Purchasing a digital invitation gives you the flexibility to quickly send out event invitations and digitally save a copy of your invitation you can look at years later.

You can also choose to print your digital invitation on your printer, at a local print shop, from Zazzle, or all 3 if you want.

Tags

Invitations
watercolorgirly pinkprincess birthday partywhite and pinkcinderellafairytalemagical fairyroyal5th birthdayphoto
All Products
watercolorgirly pinkprincess birthday partywhite and pinkcinderellafairytalemagical fairyroyal5th birthdayphoto

Other Info

Product ID: 256411210124026350
Created on: 3/24/2024, 6:52 AM
Rating: G