• Events
Tap / click on image to see more RealViewsTM
The lace detailed are simulated in the artwork. No actual lace will be used in the making of this product.
Sale Price $11.78.  
Original Price $13.85 Comp. value
per notebook
You save 15%

Daisy Chain - Notebook (Bright Pink)

Qty:

    Other designs from this category

    About Notebooks

    Sold by

    Style: 6.5" x 8.75" Classic Notebook

    Organize your day with a custom notebook! Made with your images and text on the front cover, this notebook is a great way to show off your personal style and keep track of all important notes and appointments all at once.

    • Dimensions: 6.5" x 8.75"
    • Cover printed in vibrant, sharp color
    • 80 black & white lined pages
    • College ruled
    • Lay flat spiral binding
    This product is recommended for ages 8+.
    Designer Tip: To ensure the highest quality print, please note that this product’s customizable design area measures 6.5" x 8.75". For best results please add 1/8" bleed.

    About This Design

    The lace detailed are simulated in the artwork. No actual lace will be used in the making of this product.
    Daisy Chain - Notebook (Bright Pink)

    Daisy Chain - Notebook (Bright Pink)

    A modern take on a sweet floral motif, Daisy Chain feels both playful and refined. The repeating pattern brings movement and rhythm, while the high-contrast palette keeps it crisp and graphic. Designed with a Scandinavian sensibility—simple, bold, and intentional—this adds personality without feeling overdone. It’s the kind of piece that stands out on its own but still works effortlessly with everything else you carry. Lighthearted, modern, and a little unexpected—this is everyday design done right.

    Customer Reviews

    4.8 out of 5 stars rating1.8K Total Reviews
    1502 total 5-star reviews185 total 4-star reviews41 total 3-star reviews27 total 2-star reviews14 total 1-star reviews
    1,769 Reviews
    Reviews for similar products
    5.0 out of 5 stars rating
    5 out of 5 stars rating
    By Joanna M.October 4, 2023Verified Purchase
    6.5" x 8.75" Classic Notebook
    Zazzle Reviewer Program
    Met my expectations perfectly. Quality notebook with lined paper. Good size and good amount of pages. I used my own design and added the birds. Color of scenery was beautiful and dark printing exceptional with the light background.
    5.0 out of 5 stars rating
    5 out of 5 stars rating
    By VanessaMay 11, 2020Verified Purchase
    6.5" x 8.75" Classic Notebook
    Zazzle Reviewer Program
    The print came out beautifully and the color wreath was bright and vibrant. I gave it as a gift for Mother's Day and my mom loved it. The customization came in key and Zazzle has plenty of customized type (and symbol!) options - really great cover! Printing was great!! Wreath was bright and vivid like the photo!
    5.0 out of 5 stars rating
    5 out of 5 stars rating
    By Erica E.March 6, 2020Verified Purchase
    6.5" x 8.75" Classic Notebook
    Zazzle Reviewer Program
    I love my notebook! Very simple, but perfect for my wedding notes to keep track of everything! It was very easy to edit my design & personalize it. Nice quality. Would recommend! I did edit the design slightly besides personalizing. I my looks exactly has I had designed it! Not pixelated at all.

    Tags

    Notebooks
    modernscandinavianartsyfloraldaisylacepinkgirlydelicatefeminine
    All Products
    modernscandinavianartsyfloraldaisylacepinkgirlydelicatefeminine

    Other Info

    Product ID: 256029940409343732
    Created on: 3/27/2026, 3:26 PM
    Rating: G