Tap / click on image to see more RealViewsTM
Sale Price $9.45.  
Original Price $11.10. Comp. value
Sale Price $3.15per sheet of tissue paper.
You save 15%

Distressed Sun Decoupage Tissue Paper

Qty:

Other designs from this category

About Tissue Paper

Sold by

Size: 18" x 24"

Make all of your gifts perfectly unique with personalized tissue paper. Give your gifts a sweet, personal touch with designs, photos, images, and text printed on this gift wrapping essential. Impress your friends and family with your amazing style!

  • Please note that this size tissue arrives folded
  • Dimensions: 18” l x 24” w unfolded
  • Full color edge-to-edge print
  • 10lb paper is great for wrapping jewelry, small gifts and party favors
  • 18lb paper is thicker than standard tissue paper and provides more padding for delicate or heavier items
  • Allows for easy stuffing
  • Not intended for food contact use

About This Design

Distressed Sun Decoupage Tissue Paper

Distressed Sun Decoupage Tissue Paper

Unleash the warmth and allure of the sun with this exquisite Distressed Sun Decoupage Tissue Paper. Its vintage-inspired design evokes a sense of nostalgic charm and tranquility. Crafted with meticulous detail, the tissue paper features a distressed sun motif, rendered in ethereal shades of gold and amber. The aged effect lends an air of timelessness, inviting you to create projects that resonate with both the past and present. Whether you’re a seasoned artist, a home décor enthusiast, or simply seeking to add a touch of warmth to your life, this high-quality tissue paper is the perfect companion. Its versatility allows you to transform ordinary surfaces into extraordinary works of art. -Distressed sun design for a vintage esthetic -Shimmering gold and amber hues add depth and warmth -Premium tissue paper ensures durability and ease of use -Ideal for découpage, mixed media, scrapbooking, and other creative projects.

Customer Reviews

4.8 out of 5 stars rating2.8K Total Reviews
2547 total 5-star reviews145 total 4-star reviews47 total 3-star reviews25 total 2-star reviews42 total 1-star reviews
2,806 Reviews
Reviews for similar products
5 out of 5 stars rating
By Tracey G.March 8, 2024Verified Purchase
Custom 18lb Tissue Paper, Size: 10" x 14"
Love this paper I’ve been looking for something like this for a while now and it’s perfect I love the colors. I love this print I put two of the same papers together because my project was a bit bigger than the papers I ordered, but it turned out absolutely beautiful. I love it.
5 out of 5 stars rating
By Babcia K.January 30, 2024Verified Purchase
Custom 18lb Tissue Paper, Size: 21" x 29"
Zazzle Reviewer Program
Easy to work with, the colors were as shown online, the weight of the paper was nice. I turned an old refrigerator box into a bookshelf in a guest bedroom / reading room. The paper went on clean, the ink did not run when finish was applied. I love the way it turned out! Sharp, no muddied spots
5 out of 5 stars rating
By Janis B.January 3, 2026Verified Purchase
Custom 10lb Tissue Paper, Size: 10" x 14"
I had a small table I had just painted and wanted to add a bit of a romantic touch. This paper decoupaged on the top was just what it needed it always elicits oohs and aahs. Can’t wait to try more designs. .

Tags

Tissue Paper
decoupagesunmagicmysticalancientfacepagannew agefantasysurreal
All Products
decoupagesunmagicmysticalancientfacepagannew agefantasysurreal

Other Info

Product ID: 256055763715191733
Created on: 8/16/2024, 6:13 PM
Rating: G