Tap / click on image to see more RealViewsTM
The glitter details are simulated in the artwork. No actual glitter will be used in the making of this product.
Sale Price $38.04.  
Original Price $44.75 Comp. value
per clock
You save 15%

Elegant Blush Pink & Silver Glitter Drip Square Wall Clock

Qty:
10.75" Square Acrylic
-$5.15
-$5.00
-$5.00
-$5.00

Other designs from this category

About Wall Clocks

Sold by

Style: 10.75" Square Acrylic Wall Clock

Customize your wall clock to create a functional wall décor statement piece to perfectly match your home décor, show off your art or favorite photo, or give as a personalized gift. This unique, high-quality wall clock is vibrantly printed with AcryliPrint®HD process and features a pre-installed backside hanging slot for easy hanging and a non-ticking design.

  • Size: 10.75" L x 10.75" H
  • Material: Grade-A acrylic
  • One AA battery required (not included)
  • Add photos, artwork, and text
  • Indoor use only, not recommended for outdoor use
California Residents: Prop 65 Disclaimer
WarningWARNING: This product can expose you to chemicals including lead, which is known to the State of California to cause cancer and birth defects or other reproductive harm. For more information, go to www.P65Warnings.ca.gov.

About This Design

The glitter details are simulated in the artwork. No actual glitter will be used in the making of this product.
Elegant Blush Pink & Silver Glitter Drip  Square Wall Clock

Elegant Blush Pink & Silver Glitter Drip Square Wall Clock

Add a touch of luxury to your space with this elegant Pink Luxe Drip wall clock, featuring shimmering silver and blush pink glitter drips in a circular-shaped motif. Perfect for glam rooms, modern bedrooms, or feminine office décor, this chic timepiece is as functional as it is fabulous. A stunning gift for housewarmings, birthdays, or anyone who loves a little sparkle!

Customer Reviews

4.7 out of 5 stars rating3.4K Total Reviews
2816 total 5-star reviews383 total 4-star reviews76 total 3-star reviews42 total 2-star reviews61 total 1-star reviews
3,378 Reviews
Reviews for similar products
5 out of 5 stars rating
By A.September 16, 2021Verified Purchase
Wall Clock, 8" Round Acrylic
Zazzle Reviewer Program
This clock is so cute! Loved that I could personalize it with my daughter’s name. She just got her big girl bed so we decorated with unicorns. I thought this would be good to have in her room. We are using it to help her learn how to tell time. She absolutely loves it! The color was just like the design on the website. Everything turned out just as I expected.
5 out of 5 stars rating
By Tracey P.June 11, 2025Verified Purchase
Wall Clock, 10.75" Square Acrylic
This clock is even cuter in hand , matches the bee decor in my kitchen perfect! Zazzle really has the nicest items , turned around and ordered bee candy jars. Thank You 😁.
5 out of 5 stars rating
By Lisa S.September 21, 2025Verified Purchase
Wall Clock, 10.75" Square Acrylic
Wow this clock is beyond beautiful in person. I love the design I choose, which is my logo for my dessert business. Thank you so much for making sure it was packed so neatly and safe. I’m thankful for the outcome. Fantastic job!

Tags

Wall Clocks
sparkleglittermodernglamelegantgirlysilverpink
All Products
sparkleglittermodernglamelegantgirlysilverpink

Other Info

Product ID: 256577969356106432
Created on: 9/4/2025, 12:24 PM
Rating: G