Tap / click on image to see more RealViewsTM
Sale Price $1.60.  
Original Price $3.19 Comp. value
per card
You save 50%

Elegant Leafy Art Nouveau Arts and Crafts Pattern Invitation

Qty:
Choose Your Format

Envelopes

Choose from blank envelopes or save time with addressable envelopes

Squared
+$0.20
+$0.25
+$0.25
+$0.25
+$0.25
Signature Matte
Overall Pick
18 pt thickness / 120 lb weight Soft white, soft eggshell texture
+$1.71
+$0.71
+$0.71
-$0.19
+$0.71

Other designs from this category

About Invitations

Sold by

Size: 5" x 7"

Make custom invitations and announcements for every special occasion! Choose from twelve unique paper types, two printing options, and six shape options to design a card that's perfect for you.

  • Dimensions: 5" x 7" (portrait or landscape)
  • Standard white envelope included
  • High quality, full-color, full-bleed
  • Add photos and text to both sides of this flat card at no extra charge
  • Two printing options available: Standard and High-Definition
  • 12 unique paper types and colors to choose from
  • Designer Tip: To ensure the highest quality print, please note that this product’s customizable design area measures 5" x 7". For best results please add 1/16" bleed.

Paper Type: Signature Matte

Our Signature Matte paper is a customer favorite—smooth to the touch with a soft eggshell texture that elevates any design. Its sturdy 18 pt weight and natural feel make it the ideal choice for timeless, sophisticated events.

  • Exclusively made for Zazzle
  • Made and Printed in the USA
  • FSC® Certified—sourced from responsibly managed forests that protect both people and planet

About This Design

Elegant Leafy Art Nouveau Arts and Crafts Pattern Invitation

Elegant Leafy Art Nouveau Arts and Crafts Pattern Invitation

Chic vintage look with a customizable background color. Original leave pattern motif by Village Design.

Customer Reviews

4.8 out of 5 stars rating68.5K Total Reviews
60688 total 5-star reviews5618 total 4-star reviews986 total 3-star reviews461 total 2-star reviews705 total 1-star reviews
68,458 Reviews
Reviews for similar products
5 out of 5 stars rating
By Margaret O.September 22, 2021Verified Purchase
Flat Invitation, Size: 5" x 7", Paper: Signature Matte, Corner: Squared, Envelopes: White, Print Quality: Standard
Zazzle Reviewer Program
After cruising the Internet for weeks for an invitation to an 85th birthday party for a life-long car enthusiast, we landed at Zazzle. All our guests raved about the invitation: a racy exotic car that said it all and helped set the theme for the event. Who ever knows what to expect when ordering online from a new company? The high caliber of the card stock and print job were a great relief. Moreover, the order was executed quickly and efficiently. We were so pleased that we used Zazzle soon after for another print job.
5 out of 5 stars rating
By Kathryn L.October 18, 2020Verified Purchase
Flat Invitation, Size: 5" x 7", Paper: Signature Matte, Corner: Squared, Envelopes: White, Print Quality: Standard
Zazzle Reviewer Program
The product exceeded my expectations and was of high quality. the paper was thick and was a perfect invitation for my wedding. the colors were just as expected and vibrant. I have no worries that those receiving the invitations will know how much work was put into the product.
5 out of 5 stars rating
By AnonymousFebruary 10, 2022Verified Purchase
Flat Invitation, Size: 5" x 7", Paper: Signature Matte, Corner: Squared, Envelopes: White, Print Quality: Standard
Zazzle Reviewer Program
We ordered this invitation first as just a sample because I loved the color combination. We ordered many other samples invitations (thanks to Zazzle Black). But ultimately ended up coming back to this (our first) because is simply was exactly what I was looking for. I actually ended up using the color pallet for our entire wedding! We had an outdoor ceremony and inside reception and these invitations were the perfect introduction for our guests to the type of event we were planning. Not too fancy but also not a casual evening wedding. The colors were vibrant and the paper was just the right amount of weight. We ordered the matching RSVP cards, the mauve envelopes with return address printed on the back, the belly bands to tie it all together, and the menus. Postage to send all this out was only .78 each. We highly recommend these invites and this seller was very responsive, our orders went out very timely. Thank you so much! We were so happy with all your paper products! I was extremely satisfied with the colors of our invitations. I couldn't have been happier with the print!

Tags

Invitations
art nouveauvintagevictorianpatternleavesleafygreentealaquaelegant
All Products
art nouveauvintagevictorianpatternleavesleafygreentealaquaelegant

Other Info

Product ID: 161983976605672037
Created on: 10/29/2012, 2:02 PM
Rating: G