Tap / click on image to see more RealViewsTM
Sale Price $13.68.  
Original Price $17.10 Comp. value
per mouse pad
You save 20%

Elegant Leafy Art Nouveau Arts and Crafts Pattern Mouse Pad

Qty:
Personalize this template

Other designs from this category

About Mousepads

Sold by

Style: Mouse Pad

Create a great accessory for the only mouse you want scurrying around with a custom mouse pad for your home or office! Decorate it with your favorite image or choose from thousands of designs that look great and protect your mouse from scratches and debris. You can also design fun mouse pads to hand out to new employees or to use as marketing materials!

  • Dimensions: 9.25"l x 7.75"w
  • High quality, full-color printing
  • Durable and dust and stain resistant cloth cover
  • Non-slip rubber backing
  • Designer Tip: To ensure the highest quality print, please note that this product’s customizable design area measures 9.25" x 7.75"

About This Design

Elegant Leafy Art Nouveau Arts and Crafts Pattern Mouse Pad

Elegant Leafy Art Nouveau Arts and Crafts Pattern Mouse Pad

Chic vintage look with a customizable background color. Original leave pattern motif by Village Design.

Customer Reviews

4.8 out of 5 stars rating4.7K Total Reviews
4155 total 5-star reviews377 total 4-star reviews73 total 3-star reviews26 total 2-star reviews25 total 1-star reviews
4,656 Reviews
Reviews for similar products
5 out of 5 stars rating
By Fernando G.July 22, 2024Verified Purchase
Mousepad
Creator Review
It was meant for me and my wife. We wanted to collect all mouse pads that shows the different seasons. It turn out to be a nice quality with a winter scene. The printing was done in good quality and we are satisfied.
5 out of 5 stars rating
By X.October 2, 2020Verified Purchase
Mousepad
Zazzle Reviewer Program
It was time for a new mouse pad and being that I am at the computer so much, I wanted something pleasing to look at. I was completely floored when I received this one from Zazzle. The quality is great, and at such a great price! I paid a little over $15.00 - and with it being a custom photo??? - can't beat that! The photo of my pup was even better than the original that I took with my iphone - no special zoom camera. I wasn't sure if it would maintain quality when being blown up for the mouse pad size but WOW - the colors are vibrant, and it actually looks like my sweet pup is actually looking at me...... so so so so very happy with the result!
5 out of 5 stars rating
By AnonymousJuly 2, 2024Verified Purchase
Mousepad
I chose to order my mouse pad from Zazzle because I had ordered some custom stickers for a project that I was working on 2022. I was very pleased with the stickers, so I decided that I would order my mouse pad from "Zazzle" because I wanted a mouse pad that really represents my dental office. The mouse pad that I was currently using was a promotional item sent to my office by a dental lab. Recently, it started to look a little worn and had several cracks in it. I was happy that you could do your own custom design on the website. When I received the mouse pad, I was very happy with its' appearance. Quite frankly, it looks great. I love it so much that I want to have a a tee shirt and a coffee mug with the same design. I would definitely purchase this mouse pad again. Thank you so much "Zazzle"!! The quality of the mouse pad is excellent. It looks great and is durable. AAA+ . The printing looks great. It exceeded my expectations. I love it!!

Tags

Mousepads
art nouveauvintagevictorianpatternleavesleafygreentealaquaelegant
All Products
art nouveauvintagevictorianpatternleavesleafygreentealaquaelegant

Other Info

Product ID: 144388314163988114
Created on: 10/29/2012, 2:02 PM
Rating: G