Tap / click on image to see more RealViewsTM
Sale Price $2.27.  
Original Price $2.67 Comp. value
per card
You save 15%

Elegant Script Botanical Christmas Photo Collage Holiday Card

Qty:
Choose Your Format

Envelopes

Choose from blank envelopes or save time with addressable envelopes

Squared
+$0.20
+$0.25
+$0.25
+$0.25
+$0.25
Signature Matte
18 pt thickness / 120 lb weight Soft white, soft eggshell texture
+$1.53
+$0.63
+$0.63
+$0.63
-$0.17

Other designs from this category

About Flat Holiday Cards

Sold by

Size: 5" x 7"

Spread joy, share cheer, merry everything and a happy always! Holiday cards designed to brighten up the entire year.

  • Dimensions: 5" L x 7" H (portrait); 7" L x 5" H (landscape)
  • High quality, full-color, full-bleed printing on both sides
  • Add photos and text for no additional charge

Paper Type: Signature Matte

Our Signature Matte paper is a customer favorite—smooth to the touch with a soft eggshell texture that elevates any design. Its sturdy 18 pt weight and natural feel make it the ideal choice for timeless, sophisticated events.

  • Exclusively made for Zazzle
  • Made and Printed in the USA
  • FSC® Certified—sourced from responsibly managed forests that protect both people and planet

About This Design

Elegant Script Botanical Christmas Photo Collage Holiday Card

Elegant Script Botanical Christmas Photo Collage Holiday Card

This multi-photo Christmas holiday card is a perfect choice this Christmas season! It features a photo collage of three favorite family photos on the top. Underneath there are your Christmas greetings in a modern whimsical elegant script. Below is your family name and year in a simple typography. The card is framed on the bottom by lovely watercolor greenery: eucalyptus and red winter berries. The reverse of the card features the same botanical motif as well as your custom Christmas wishes! Create your own perfect Christmas greeting card by clicking on the ´´Personalize´´ button and changing the pictures and wording to your own!

Customer Reviews

4.7 out of 5 stars rating10K Total Reviews
8206 total 5-star reviews1205 total 4-star reviews243 total 3-star reviews121 total 2-star reviews196 total 1-star reviews
9,971 Reviews
4 out of 5 stars rating
By James C.December 4, 2024Verified Purchase
Flat Holiday Card, Size: 5" x 7", Paper: Signature Matte, Corner: Squared, Envelopes: White
Beautiful cards, I am very pleased with the results. A few friends and family have already texted me to tell me how beautiful this year's card is, simple yet elegant. I will definitely buy my Christmas cards from Zazzle in the future. .
Reviews for similar products
5 out of 5 stars rating
By Mary S.November 9, 2021Verified Purchase
Flat Holiday Card, Size: 5" x 7", Paper: Signature Matte, Corner: Squared, Envelopes: White
Zazzle Reviewer Program
This watercolor oval wreath design was perfect for framing this excerpt of my original acrylic painting "Peaceful Winter Scene." I loved the weight and quality of the paper. I feel my Christmas card turned out beautifully. The printing and colors were very good. I do feel the design could have been centered better. My first set - the printing came out fairly close to the top. I ordered a personalized set for a client and the printing on those were not so close to the top.
5 out of 5 stars rating
By Kaliste A.December 1, 2023Verified Purchase
Flat Holiday Card, Size: 4.5" x 6.25", Paper: Signature Matte, Corner: Squared, Envelopes: White
Zazzle Reviewer Program
I really liked the "Merry Christmas" typography on this card, and that there is space for a little message. The pattern on the back is very pretty!! I ordered a sample of this card, so I didn't use my own photos, but all of the 9 images are very detailed. I was a little worried they would turn out blurry or look too small but the card looks just how I saw it on the computer screen.

How to Customize Your Card

  • Step 1: Choose your favorite design.

    Step 1:

    Choose your favorite design.

  • Step 2: Select your desired size, shape and paper type

    Step 2:

    Select your desired size, shape and paper type

  • Step 3: Click 'Personalize' to enter your custom text and images.

    Step 3:

    Click 'Personalize' to enter your custom text and images.

  • Step 4: When finished customizing your card, click 'Done' to see your final product!

    Step 4:

    When finished customizing your card, click 'Done' to see your final product!

Find Your Perfect Paper

From great value to luxurious finishes, Zazzle has you covered for the holidays

  • Signature Matte

    A customer favorite - smooth to the touch with a soft eggshell texture that elevates any design.

    • 18pt thickness
    • 120 lb / 324 GSM
  • Signature Double-Thick

    Thick, bold, and unforgettable, sure to make a statement.

    • 35pt thickness
    • 340 lb / 650 GSM
  • Basic Semi-Gloss

    Bright, smooth, and polished to bring your design to life with vibrant color and a subtle shine.

    • 16pt thickness
    • 150lb / 400 GSM
  • Premium Linen

    Offers a subtle woven finish that brings depth to minimalist and traditional designs alike.

    • 16pt thickness
    • 130 lb / 352 GSM
  • Premium Pearlescent

    Adds a luminous glow to your invitations with a soft, light-catching finish.

    • 16pt thickness
    • 130lb / 350 GSM
  • Premium Soft Touch

    Ultra-luxurious and smooth with a rich, satin feel on both sides that’s unforgettable in hand.

    • 18pt thickness
    • 212 lb / 345 GSM

Did you know, you can also customize the back? Use the design tool to try it out and customize even more!

The Zazzle Promise

  • Love It Guarantee

    Don't love it? We'll take it back! Enjoy our “100% Love It Guarantee.”

  • FREE Shipping

    Enjoy FREE shipping with a 30-day free trial of Zazzle Plus – Learn More!

  • Secure Shopping Guaranteed

    100% Secure payment with SSL Encryption.

Tags

Flat Holiday Cards
christmas greenerywatercolorbotanicalphoto collagemulti photo christmasmodernscriptelegantwhimsicalfamily photos christmas holidays
All Products
christmas greenerywatercolorbotanicalphoto collagemulti photo christmasmodernscriptelegantwhimsicalfamily photos christmas holidays

Other Info

Product ID: 256903441749600233
Created on: 9/26/2023, 11:53 PM
Rating: G