Tap / click on image to see more RealViewsTM
Sale Price $21.47.  
Original Price $25.25 Comp. value
per towel
You save 15%

Elegant Thanksgiving Pear Wreath Illustration Kitchen Towel

Qty:

Other designs from this category

About Kitchen Towels

Sold by

Style: Kitchen Towel 16" x 24"

Brighten up any kitchen with new kitchen towels! Made of durable poly-blend, these towels are great for drying and will look vibrant with your text, monogram, or artwork. Designed for a lifetime of use, these machine washable kitchen towels look great and clean up well, too!

  • Dimensions: 16" x 24"
  • 80% durable woven polyester/ 20% polyamide blend microfiber
  • White-colored back-side is non-customizable
  • Machine washable
  • Imported, printed in the USA
Designer Tip: To ensure the highest quality print, please note that this product’s customizable design area measures 16" x 24". For best results please add 5/7" bleed.

About This Design

Elegant Thanksgiving Pear Wreath Illustration Kitchen Towel

Elegant Thanksgiving Pear Wreath Illustration Kitchen Towel

Modern Thanksgiving Wreath Fall Motif Towel

Customer Reviews

4.8 out of 5 stars rating1.2K Total Reviews
1010 total 5-star reviews118 total 4-star reviews37 total 3-star reviews13 total 2-star reviews16 total 1-star reviews
1,194 Reviews
Reviews for similar products
5 out of 5 stars rating
By Corinne D.February 7, 2018Verified Purchase
Kitchen Towel
Creator Review
My photos don’t do the colors of my gorgeous kitchen towel justice. It’s absolutely beautiful! The printing is gorgeous!
5 out of 5 stars rating
By Donald M.February 3, 2019Verified Purchase
Kitchen Towel
Creator Review
Ecstatic, Eccentric, Eclectic - Excellent, absorbent kitchen towels with vibrant designs. Excellent! Rich pure colors.
5 out of 5 stars rating
By R.August 25, 2015Verified Purchase
Kitchen Towel
Zazzle Reviewer Program
I didn't really know how the quality would be of this towel but after receiving it, i realized it reminded me of my very highest quality car towels, microfiber type. I just bought a new Mercedes AMG GT with suede seating that I don't want to even sit on without some sort of cover. I laid these towels on each seat...i bought two. :)lol! My German car now has two matching German imaged towels. The color and print is stunning...beyond high quality. Love them but they're really just too pretty to use for hand towels which is what i had bought them for originally! ...lol Thanks! Rich and colorful, beyond stunning color and print quality.

Tags

Kitchen Towels
fallautumnleavesgreeneryleafthanksgivingthanksgiving giftsthankfulbranchwreath
All Products
fallautumnleavesgreeneryleafthanksgivingthanksgiving giftsthankfulbranchwreath

Other Info

Product ID: 197652513096200298
Created on: 11/1/2020, 7:18 AM
Rating: G