Tap / click on image to see more RealViewsTM
Sale Price $7.95.  
Original Price $9.35 Comp. value
per sheet of 20
You save 15%

Elf Designs :: Magical by MarloDee Designs Square Sticker

Qty:
Square Stickers
+$0.35
+$0.35
+$0.35

Other designs from this category

About Stickers

Sold by

Shape: Square Stickers

Create custom stickers for every occasion! From special mailings and scrapbooking to kids' activities and DIY projects, you'll find these stickers are great for so many uses. Add your own designs, patterns, text, and pictures!

  • Dimensions: Available in 2 sizes:
    • Large: 3" L x 3" W, 6 stickers per sheet
    • Small: 1.5" L x 1.5" W, 20 stickers per sheet
  • Printed on white acid-free paper
  • Vibrant full-color, full-bleed printing
  • Scratch-resistant front, easy peel-and-stick back
  • Available in a matte or glossy finish
  • Choose between a variety of different shapes

About This Design

Elf Designs :: Magical by MarloDee Designs Square Sticker

Elf Designs :: Magical by MarloDee Designs Square Sticker

A lovely elf and a hummingbird together is Magical....( © 2004-2015 MarloDee Designs (www.marlodeedesigns.com) : All rights reserved. Images on this site are not public domain. You may not copy, duplicate, alter or scan these designs, images, illustrations, photography, art and writing.

Customer Reviews

4.8 out of 5 stars rating26.5K Total Reviews
22981 total 5-star reviews2172 total 4-star reviews548 total 3-star reviews333 total 2-star reviews497 total 1-star reviews
26,531 Reviews
Reviews for similar products
5 out of 5 stars rating
By Suzi G.October 22, 2025Verified Purchase
Custom Square Stickers, Format: Sheet of Stickers, Size: Small, 1½ inch (sheet of 20), Paper Type: Glossy White Paper
Definitely loving how these Çreate your own square Stiçkers came out! Wow, the çolors are beautiful. I like the wày Í could pút in a Border àß wéll as çhoose the background sceñery of the stiçker! Yay, thank you once again Zazzle¡!😁👍🙂.
5 out of 5 stars rating
By Charity v.January 12, 2022Verified Purchase
Custom Square Stickers, Format: Sheet of Stickers, Size: Small, 1½ inch (sheet of 20), Paper Type: Glossy White Paper
Zazzle Reviewer Program
This is a very easy to use product and very affordable compared to the price of other custom stickers if seen. The printing is exactly the way I created it. So double check your work.
5 out of 5 stars rating
By Suzi G.September 19, 2025Verified Purchase
Custom Square Stickers, Format: Sheet of Stickers, Size: Small, 1½ inch (sheet of 20), Paper Type: Glossy White Paper
Awesome Stickers that really show the pastel colors. Luv the borders & background a lot Site is glitchy but otherwise all's good 👍😊.

Tags

Stickers
elffairyfaemagicmagikmagikalwitchhummingbirdfantasyspell
All Products
elffairyfaemagicmagikmagikalwitchhummingbirdfantasyspell

Other Info

Product ID: 217259878938441739
Created on: 10/11/2011, 1:05 PM
Rating: G