Tap / click on image to see more RealViewsTM
Sale Price $18.36.  
Original Price $22.95 Comp. value
per skin
You save 20% ends today

Experience the Beauty of a Blue Sky with a Plane HP Laptop Skin

Qty:
Personalize this template

Other designs from this category

About HP Laptop Skins

Sold by

Model: HP EliteBook X360 1030 G3/G4

When you spend as much time on your laptop as we do, you want to make sure it's a true extension of yourself. Easily show personality and character with a custom laptop skin.

  • Custom cut to fit HP EliteBook X360 1030 G3/G4 (2018)
  • 4 mil Ultra Digital® Flexible Vinyl
  • Printed on HP Indigo 7900 Digital Press for vibrant colors and sharp line detail
  • Easy, bubble-free installation (reposition if needed)
  • Thin but tough; help protect your computer against minor scratches
  • Available in a glossy and matte finish
  • Easy to remove; no sticky residue

About This Design

Experience the Beauty of a Blue Sky with a Plane HP Laptop Skin

Experience the Beauty of a Blue Sky with a Plane HP Laptop Skin

Discover the serene beauty of a clear blue sky as an aircraft soars through the clouds on a sunny day. Witness the magic of aviation and travel in the vast sky.

Customer Reviews

4.0 out of 5 stars rating27 Total Reviews
15 total 5-star reviews5 total 4-star reviews3 total 3-star reviews0 total 2-star reviews4 total 1-star reviews
27 Reviews
Reviews for similar products
5 out of 5 stars rating
By Jennifer J.September 20, 2022Verified Purchase
HP Laptop 15t/15z, HP 250/255 G7 Notebook PC Skin, White, No Underbase, Matte
Creator Review
The product itself is just perfect. I was very impressed at how well it was protected during shipping. And the fit was just right even though my laptop is a bit older. I looked up the dimensions and had my fingers crossed and it was just right. It even came with a smoothing tool to make sure there were no wrinkles. I did clean the laptop with glasses cleaner really well first as recommended. I picked the opaque background since my laptop is rose gold. The colors just popped. It's a bit bold, but that's what I wanted. It makes me want to get to work. Just love it!
5 out of 5 stars rating
By Leslie L.October 6, 2019Verified Purchase
Zazzle Reviewer Program
I have an HP Probook and had been waiting for the generic laptop skins to come back in stock, but got tired of waiting and decided to look up measurements online of the HP Elitebooks and see if I could find a skin that I could just trim down to fit mine. The measurements for this model was very close to the measurements for my laptop and I went ahead and took a chance getting the decal for the elitebook 850 and it fits great! I didn’t have to do any trimming and there is just a small border around it which looks fine considering the hinge placement anyway. It was pretty easy to put on and comes with a squeegee tool to help you smooth it. It is best to get as few bubbles as possible on the initial application though. It seems durable and like it will provide protection for my slightly soft, easily scratched laptop lid. Once again, this is my go to designer for amazing, unique artwork and I love everything I have ordered from her shop! The printing Is gorgeous! Vivid and crisp and colorful. I got the glossy white so that the colors would really pop and the black sketch work looks great with my smokey black laptop. I no issues with scratching the ink or the vinyl during application.
Original product
4 out of 5 stars rating
By ANGELA B.October 5, 2022Verified Purchase
HP Laptop 15t/15z, HP 250/255 G7 Notebook PC Skin, White, No Underbase, Matte
Zazzle Reviewer Program
Quality is good it was fairly simple to apply to my laptop, however, it did need a bit trimmed off at the sides to fit correctly over my laptop and corners are not perfectly smooth but all-in-all good. Not a big effort in trimming it off with a trusty craft knife. Regarding the durability of the product it seems to withstand the wear and pressure to date but time will tell over its longevity. It has met my expectations. Design of the product was excellent. I have had positive comments about it already :) The colours turned out as I had hoped which I am really pleased about; the colour mint is spot on! I was pleasantly surprised I got what I wanted - the cherry blossom design is an exact replica of my tattoo! Very satisfied with the image quality it is lovely, big, clear and beautifully designed - Thank you!

Tags

HP Laptop Skins
blue skyplaneflyingskyaircraftaviationcloudssunny daytravelhorizon
All Products
blue skyplaneflyingskyaircraftaviationcloudssunny daytravelhorizon

Other Info

Product ID: 256143188284303685
Created on: 4/19/2024, 2:09 AM
Rating: G