Tap / click on image to see more RealViewsTM
Sale Price $2.99.  
Original Price $3.51 Comp. value
per card
You save 15%

Fairy Circle by Arthur Rackham Card

Qty:
Choose Your Format

Envelopes

Choose from blank envelopes or save time with addressable envelopes

Signature Matte
18 pt thickness / 120 lb weight Soft white, soft eggshell texture
+$0.59
+$0.59
-$0.16

Other designs from this category

About Folded Greeting Cards

Sold by

Size: Standard, 5" x 7"

Thank you, hello, or I love you, custom greeting cards are thoughtful gifts that are always the perfect way to express yourself.

  • Dimensions: 5" x 7" (portrait); 7" x 5" (landscape)
  • Full color CMYK print process
  • Double sided printing for no additional cost

Paper Type: Signature Matte

Our Signature Matte paper is a customer favorite—smooth to the touch with a soft eggshell texture that elevates any design. Its sturdy 18 pt weight and natural feel make it the ideal choice for timeless, sophisticated events.

  • Exclusively made for Zazzle
  • Made and Printed in the USA
  • FSC® Certified—sourced from responsibly managed forests that protect both people and planet

About This Design

Fairy Circle by Arthur Rackham Card

Fairy Circle by Arthur Rackham Card

The fairies are celebrating. It is for A Midsummer Night's Dream. The colors are great. It is public domain.

Customer Reviews

4.9 out of 5 stars rating17.4K Total Reviews
16391 total 5-star reviews718 total 4-star reviews125 total 3-star reviews64 total 2-star reviews129 total 1-star reviews
17,427 Reviews
Reviews for similar products
5 out of 5 stars rating
By Michelle H.July 15, 2025Verified Purchase
Folded Greeting Card, Size: Standard, 5" x 7", Paper: Signature Matte, Envelopes: White
I was searching high and low for an invitation that went with a fire theme (account my mom wants 70 real live burning candles on the cake) surprise birthday party. I found these and couldn’t buy them quick enough! They far exceeded my expectations! One word of caution is that they default to matte so if you want glossy finish you have to manually select it. I only changed where the 2 clip art pics were located to make space for the text. I even used the default font for the design. Comes with nice white envelopes that don’t need the upgrade. The feedback from the invitees has been amazing. Thanks Cathy for an amazing product!! *please note I redacted sensitive information on the pictures with black mark out. .
5 out of 5 stars rating
By Kelli T.July 23, 2021Verified Purchase
Folded Greeting Card, Size: Standard, 5" x 7", Paper: Signature Matte, Envelopes: White
Zazzle Reviewer Program
This was my first time ordering from Zazzle. I was not disappointed! The card was amazing. I personalized it and that made it even more special. The amazing quality of the card was definitely noticeable. And you really can’t complain about the prices. Perfect. Clear. Not too dark, not too light. Just like it looked online.
5 out of 5 stars rating
By Vivian W.November 18, 2020Verified Purchase
Folded Greeting Card, Size: Standard, 5" x 7", Paper: Signature Matte, Envelopes: White
Zazzle Reviewer Program
I have ordered many cards from Zazzle and the quality is outstanding. They design and deliver expeditiously. I highly recommend them. The printing was beautiful.

Tags

Folded Greeting Cards
fairiesfairyartarthurrackhamshakespearetreeplaywhite
All Products
fairiesfairyartarthurrackhamshakespearetreeplaywhite

Other Info

Product ID: 256603442933343167
Created on: 3/19/2019, 9:05 PM
Rating: G