Tap / click on image to see more RealViewsTM
Sale Price $40.00.  
Original Price $50.00. Comp. value
Sale Price $0.80per candy.
You save 20%

Fairytale Castle Perfect Birthday and Fantasy Gift Reese's Peanut Butter Cups

Qty:

Other designs from this category

About Hershey's Candy Favorss

Sold by

Style: Reese's Miniatures Milk Chocolate Peanut Butter Cups

The perfect blend of peanut butter and creamy milk chocolate find themselves perfectly packaged, individually wrapped and personalized making them a simply scrumptious party favor, for everyone... anytime... any occasion! It's hard to eat just one Reese's Peanut Butter Cups Miniatures!

  • Proudly made in the USA
  • Great For Gifts and Favors
  • The Sweetest Favors for your Special Day
  • Easily self assembled with self-adhesive labels
  • Purchase pre-assembled for an upcharge
  • Dimensions: 1.25"w x .75"h
  • Suggested quantity per guest: 5-10
  • Kosher ⓊD
  • Store at room temperature
  • Allergy Information: Hershey's Reese's Peanut Butter Cups Miniatures contain peanuts. For complete information regarding any Hershey's products, please contact The Hershey Company

Please note: our chocolate is shipped within its expiration dates. In the case there is white or gray discoloration and a grainy texture this is due to a process called Chocolate Bloom, which is a non-harmful occurrence that can occasionally happen with chocolate in transit, due to changes of temperature. Most importantly, your chocolate is still safe to consume.

Nutrition Facts
about 39 servings per container
Serving size 3 pieces (26g)
Amount per serving
Calories 130
Total Fat
7g, 10% (% Daily Value*)
Saturated Fat 3g, 15%
Trans Fat 0g
Cholesterol <5mg, 1%
Sodium 80mg, 3%
Total Carbohydrate 15g, 6%
Dietary Fiber <1g, 3%
Total Sugars 14g
Includes 13g Added Sugars, 26%
Protein 3g

Vitamin D 0.1mcg, 0% Calcium 30mg, 2%
Iron 0.7mg, 4%
Potassium 90mg, 2%

*The % Daily Value tells you how much a nutrient in a serving of food contributes to a daily diet. 2,000 calories a day is used for general nutrional advice.

INGREDIENTS: MILK CHOCOLATE [SUGAR: COCOA BUTTER: CHOCOLATE; SKIM MILK: MILK FAT: LACTOSE, LECITHIN (SOY); PGPR]: PEANUTS: SUGAR; DEXTROSE; SALT: TBHQ AND CITRIC ACID, TO MAINTAIN FRESHNESS.

About This Design

Fairytale Castle Perfect Birthday and Fantasy Gift Reese's Peanut Butter Cups

Fairytale Castle Perfect Birthday and Fantasy Gift Reese's Peanut Butter Cups

A magical medieval castle with stone towers stands majestically on a green meadow under a beautiful blue sky. This enchanting fairytale design is perfect for girls, kids, women and anyone who loves fantasy and romance. Great for birthday decorations, daughter or son celebrations and fairy tale themed decor. The old castle tower surrounded by trees creates a magical atmosphere ideal for fantasy lovers. Perfect design for birthday parties, bedroom decoration or as a great gift for fairytale enthusiasts of all ages!

Customer Reviews

3.8 out of 5 stars rating52 Total Reviews
29 total 5-star reviews7 total 4-star reviews2 total 3-star reviews4 total 2-star reviews10 total 1-star reviews
52 Reviews
Reviews for similar products
5 out of 5 stars rating
By Elizaverg G.April 29, 2024Verified Purchase
came out super cute for a favor for my wedding! clear and vibrant colors
5 out of 5 stars rating
By Dana B.August 13, 2023Verified Purchase
Hershey®'s Kisses® Candy Favors, Non-Assembled
Zazzle Reviewer Program
These personalized Kisses are the perfect add to my son's wedding guest gift boxes! They arrived on time packed in a styrofoam cooler with with an ice pack, alleviating my worries of not being home to bring them inside immediately from the Oklahoma summer heat! Thank you, Zazzle! Perfect image of the picture I uploaded of the bride and groom!
1 out of 5 stars rating
By Kelsee C.June 20, 2024Verified Purchase
Hershey®'s Kisses® Candy Favors, Non-Assembled
I ordered these for my blueberry themed baby shower which is only 9 days away. They seemed to be packaged well but after I pulled the bag out of the package I’m finding holes in the wrappers. Without opening the bag they were shipped in I took pictures, it was very obvious that more than half of the candy has a ripped wrapper or is already opened on the top. I can not serve my guests half opened candy, do not waste your money on this product. The labels however are beautiful and I’m now wishing I purchased only labels for the kisses and bought my own candy at walmart. .

Tags

Hershey's Candy Favorss
talelandscapefairytalepalacecastlefantasyfairymedievaltowermagical
All Products
talelandscapefairytalepalacecastlefantasyfairymedievaltowermagical

Other Info

Product ID: 256868047865091092
Created on: 10/1/2025, 6:46 AM
Rating: G