Tap / click on image to see more RealViewsTM
Sale Price $32.43.  
Original Price $38.15 Comp. value
per binder
You save 15%

Falln Gregorian Maiden 3 Ring Binder

Qty:
2" Paper Capacity
-$3.10
-$3.10

Other designs from this category

About Binders

Sold by

Size: Avery Signature 2" Binder

You’ve spent time crafting interesting reports, so why not create an eye-catching Avery custom binder to match? Showcase your business with custom client binders, proposals and reports, or design unique wedding albums, recipe books and photo albums.

  • Dimensions: 10"w x 11.75"l; Spine: 2.8"
  • 3-ring binder designed for letter (8.5" x 11") sized paper
  • 2" capacity, fits 540 pages with 1 Touch™ EZD™ Rings
  • Full bleed photo-quality printing
  • Binder inserts not included
WARNING: This product contains functional sharp points and pinch point hazards. Not for children under 8 years of age. Use with adult supervision.

Ring Type: One Touch EZD™ Ring

1" Capacity: 275 pages
1.5" Capacity: 400 pages
2" Capacity: 540 pages
Locking rings open with ease and keep pages secure.

About This Design

Falln Gregorian Maiden 3 Ring Binder

Falln Gregorian Maiden 3 Ring Binder

A gorgeous book cover from the 1600's that fell into public domain. I did digital restoration work on it, brought back the colours it once had, and made it into the beautiful art piece it is now. I left the antiqued look it has gained over the years, because I felt it added to the beauty.

Customer Reviews

4.7 out of 5 stars rating6.6K Total Reviews
5570 total 5-star reviews611 total 4-star reviews161 total 3-star reviews108 total 2-star reviews128 total 1-star reviews
6,578 Reviews
Reviews for similar products
5 out of 5 stars rating
By AnonymousJanuary 3, 2026Verified Purchase
Avery Signature Binder, 1.5" Paper Capacity
I ordered three customized binders to preserve my parents’ treasured recipes, and I couldn’t be happier with how they turned out. The binders arrived within a week, which was a wonderful surprise. The quality is really good. It is sturdy, well-made, and exactly what I was hoping for. I loved that I was able to customize them exactly the way I wanted, and the spine comfortably fit our eight-letter last name, which made the personalization feel complete and special. My parents passed away within months of each other in 2025, and I now have their red recipe box filled with so many meaningful family recipes. I wanted to share these with my siblings, so I copied all the recipes in color and placed them in sheet protectors inside the binders. They look absolutely wonderful, organized, vibrant, and truly special. These binders turned a box of memories into a beautiful keepsake, and I can’t wait to give them to my siblings. I’m so grateful to Zazzle for helping me create something that honors my parents and keeps our family traditions alive. Highly recommend!
5 out of 5 stars rating
By Susan F.January 20, 2022Verified Purchase
Avery Signature Binder, 1" Paper Capacity
Zazzle Reviewer Program
I was very pleased with my book. I took pictures & displayed it on FB . I love the fact that I could completely design everything. Awesome was very pleased.
5 out of 5 stars rating
By AnonymousMay 30, 2020Verified Purchase
Avery Signature Binder, 2" Paper Capacity
Zazzle Reviewer Program
Overall, I love my new BOS. I am currently in the process of updating and "modernizing" my original BOS, and THIS is the product I chose to house all of my information in, and so far, it is working out wonderfully. With THIS product, and its 3-ring binder that allows for ease of page insertion and removal, I am able to put my pages in wherever I want to in the book, in whatever order I want to, which I was UNABLE to do with my original, where the pages were sewn in to the binder. Also, it is made large enough to accommodate a multitude of pages; plenty to complete any large project. It has layered pocket inserts on BOTH the front AND back covers, for extra storing of papers/clippings, and it is made from a durable hard plastic material (regular binder). Although I am pleased with how it did come, I was actually expecting it to look more like what was pictured in the photo that was advertised. The advertisement says that the item is "blue-green" in color and the DESIGN of the book also APPEARS to be made of a "faux leather" FABRIC, NOT simply a design PRINTED onto a PLASTIC binder. And the book I received is more of a "gun metal grey" or "light black" color.

Tags

Binders
gregoriancelticmedievalfantasypaganspellsspellbookofshadowsmagickgrimoire
All Products
gregoriancelticmedievalfantasypaganspellsspellbookofshadowsmagickgrimoire

Other Info

Product ID: 127872599815015945
Created on: 9/20/2016, 9:26 PM
Rating: G