Tap / click on image to see more RealViewsTM
The foil and rose gold elements are simulated in the artwork by the Creator. These elements will not be used in the making of this product.
Sale Price $28.22.  
Original Price $33.20 Comp. value
per binder
You save 15%

Faux Rose Gold Foil Look Butterfly & Custom Text 3 Ring Binder

Qty:
1.5" Paper Capacity
+$2.95

Other designs from this category

About Binders

Sold by

Size: Avery Signature 1.5" Binder

You’ve spent time crafting interesting reports, so why not create an eye-catching Avery custom binder to match? Showcase your business with custom client binders, proposals and reports, or design unique wedding albums, recipe books and photo albums.

  • Dimensions: 10"w x 11.75"l; Spine: 2.2"
  • 3-ring binder designed for letter (8.5" x 11") sized paper
  • 1.5" capacity, fits 400 pages with 1 Touch™ EZD™ Rings
  • Full bleed photo-quality printing
  • Binder inserts not included
WARNING: This product contains functional sharp points and pinch point hazards. Not for children under 8 years of age. Use with adult supervision.

Ring Type: One Touch EZD™ Ring

1" Capacity: 275 pages
1.5" Capacity: 400 pages
2" Capacity: 540 pages
Locking rings open with ease and keep pages secure.

About This Design

The foil and rose gold elements are simulated in the artwork by the Creator. These elements will not be used in the making of this product.
Faux Rose Gold Foil Look Butterfly & Custom Text 3 Ring Binder

Faux Rose Gold Foil Look Butterfly & Custom Text 3 Ring Binder

Lovely butterfly shape in faux (not real) rose gold foil look-like texture. The butterfly is place as a large motif in the middle and as smaller motifs in each corner. There are also personalizable text areas on the front and on the spine. NOTICE: THE DESIGN IS A DIGITAL IMAGE AND IT WILL BE PRINTED ON THE PRODUCT.

Customer Reviews

4.7 out of 5 stars rating6.5K Total Reviews
5530 total 5-star reviews607 total 4-star reviews159 total 3-star reviews103 total 2-star reviews113 total 1-star reviews
6,512 Reviews
Reviews for similar products
5 out of 5 stars rating
By AnonymousMay 30, 2020Verified Purchase
Avery Signature Binder, 2" Paper Capacity
Zazzle Reviewer Program
Overall, I love my new BOS. I am currently in the process of updating and "modernizing" my original BOS, and THIS is the product I chose to house all of my information in, and so far, it is working out wonderfully. With THIS product, and its 3-ring binder that allows for ease of page insertion and removal, I am able to put my pages in wherever I want to in the book, in whatever order I want to, which I was UNABLE to do with my original, where the pages were sewn in to the binder. Also, it is made large enough to accommodate a multitude of pages; plenty to complete any large project. It has layered pocket inserts on BOTH the front AND back covers, for extra storing of papers/clippings, and it is made from a durable hard plastic material (regular binder). Although I am pleased with how it did come, I was actually expecting it to look more like what was pictured in the photo that was advertised. The advertisement says that the item is "blue-green" in color and the DESIGN of the book also APPEARS to be made of a "faux leather" FABRIC, NOT simply a design PRINTED onto a PLASTIC binder. And the book I received is more of a "gun metal grey" or "light black" color.
5 out of 5 stars rating
By AnonymousJanuary 3, 2026Verified Purchase
Avery Signature Binder, 1.5" Paper Capacity
I ordered three customized binders to preserve my parents’ treasured recipes, and I couldn’t be happier with how they turned out. The binders arrived within a week, which was a wonderful surprise. The quality is really good. It is sturdy, well-made, and exactly what I was hoping for. I loved that I was able to customize them exactly the way I wanted, and the spine comfortably fit our eight-letter last name, which made the personalization feel complete and special. My parents passed away within months of each other in 2025, and I now have their red recipe box filled with so many meaningful family recipes. I wanted to share these with my siblings, so I copied all the recipes in color and placed them in sheet protectors inside the binders. They look absolutely wonderful, organized, vibrant, and truly special. These binders turned a box of memories into a beautiful keepsake, and I can’t wait to give them to my siblings. I’m so grateful to Zazzle for helping me create something that honors my parents and keeps our family traditions alive. Highly recommend!
5 out of 5 stars rating
By Susan F.January 20, 2022Verified Purchase
Avery Signature Binder, 1" Paper Capacity
Zazzle Reviewer Program
I was very pleased with my book. I took pictures & displayed it on FB . I love the fact that I could completely design everything. Awesome was very pleased.

Tags

Binders
rose gold butterflyrose gold foil butterflybutterflypink butterflyfaux foil butterflygirlyfeminineelegantpinkchic
All Products
rose gold butterflyrose gold foil butterflybutterflypink butterflyfaux foil butterflygirlyfeminineelegantpinkchic

Other Info

Product ID: 127677546342198148
Created on: 7/4/2021, 4:06 AM
Rating: G