Tap / click on image to see more RealViewsTM
Sale Price $17.01.  
Original Price $18.90 Comp. value
per ornament
You save 10%

Feliz Navidad - Mallards Ceramic Ornament

Qty:
Ceramic Circle Ornament
+$3.65
+$3.65
-$1.20
-$1.20
-$1.20
+$2.40
+$2.40
+$2.40
+$9.70
+$9.70

Other designs from this category

About Ornaments

Sold by

Style: Ceramic Circle Ornament

Bring a lot more holiday cheer to your tree with a custom ceramic ornament. Add family photos, images and personal message to both sides of this ornament. A strand of gold thread makes it easy to hang this fantastic keepsake.

  • Dimensions:
    • Diameter: 2.87"
    • Thickness: 0.156"
    • Weight: 1.4 oz.
  • Made of white porcelain
  • Full-color, full-bleed printing
  • Printing on both sides
  • Thread does not come attached/tied
  • Designer Tip: To ensure the highest quality print, please note that this product’s customizable design area measures 2.87" x 2.87". For best results please add 1/8" bleed.

About This Design

Feliz Navidad - Mallards Ceramic Ornament

Feliz Navidad - Mallards Ceramic Ornament

Two Mallard ducks, a drake and a female, swim together in an Alaskan pond. Spanish text reading, "Feliz Navidad" appears in red. The Mallard, Anas platyrhynchos, breeds throughout the temperate and subtropical Americas, Europe, Asia, and North Africa, and has been introduced to New Zealand and Australia. Male birds have a bright green or blue head, while the female's is light brown. The gregarious Mallard lives in wetlands and eats water plants. The Mallard is the ancestor of most domestic ducks. The Mallard was one of the many bird species originally described by Linnaeus in his 18th century work, Systema Naturae, and still bears the first binomial name it was given. The name is derived from the Old French malart or mallart "wild drake", although its ultimate derivation is unclear. It may be related to an Old High German masculine proper name Madelhart, clues lying in the alternate English forms "maudelard" or "mawdelard." Mallards frequently interbreed with their closest relatives in the genus Anas, such as the American Black Duck, and also with species more distantly related, for example the Northern Pintail, leading to various hybrids that may be fully fertile. This is quite unusual, and indicates that the Mallard evolved very rapidly during the Late Pleistocene. Mallards appear to be closer to their Indo-Pacific relatives than to their American ones judging from biogeography. Considering mtDNA D-loop sequence data, they may have evolved more probably than not in the general area of Siberia; Mallard bones rather abruptly appear in food remains of ancient humans and other deposits of fossil bones in Europe, without a good candidate for a local predecessor species.The large ice age paleosubspecies which made up at least the European and west Asian populations during the Pleistocene has been named Anas platyrhynchos palaeoboschas. The Mallard is 20–26 inches long (of which the body makes up around two-thirds), has a wingspan of 32–39 inches, and weighs 1.6–3.5 lbs. The size of the Mallard varies clinally, and birds from Greenland, although larger than birds further south, have smaller bills and are stockier. It is sometimes separated as subspecies, the Greenland Mallard (A. p. conboschas).The Mallard is a rare example of both Allen's Rule and Bergmann's Rule in birds. Bergmann's Rule, which states that polar forms tend to be larger than related ones from warmer climates, has numerous examples in birds. Allen's Rule says that appendages like ears tend to be smaller in polar forms to minimize heat loss, and larger in tropical and desert equivalents to facilitate heat diffusion, and that the polar taxa are stockier overall. Examples of this rule in birds are rare, as they lack external ears. However, the bill of ducks is very well supplied with blood vessels and is vulnerable to cold. Breeding males are unmistakable, with a bright bottle-green heads, a black rear end and a yellowish orange (can also contain some red) bill tipped with black (as opposed to the black/orange bill in females). They have a white collar which demarcates the head from the purple-tinged brown breast, grey brown wings, and a pale grey belly. The dark tail has white borders. The female Mallard is a mottled light brown, like most female dabbling ducks, and has buff cheeks, eyebrow, throat and neck with a darker crown and eye-stripe. Upon hatching, the plumage coloring of the duckling is yellow on the underside and face (with streaks by the eyes) and black on the backside (with some yellow spots) all the way to the top and back of the head. Its legs and bill are also black. As it nears a month in age, the duckling's plumage will start becoming drab, looking more like the female (though its plumage is more streaked) and its legs will lose their dark grey coloring. Two months after hatching, the fledgling period has ended and the duckling is now a juvenile. Between three to four months of age, the juvenile can finally begin flying as its wings are fully developed for flight (which can be confirmed by the sight of purple speculum feathers). Its bill will soon lose its dark grey coloring and whether it is male or female can finally be distinguished by three factors. The bill coloring is yellow in males, black and orange for females. The breast feathers are reddish-brown for males, brown for females. The center tail feather of male birds (called a drake feather) is curved; females have straight feathers. During the final period of maturity leading up to adulthood (6–10 months of age), the plumage of female juveniles remains the same while the plumage of male juveniles slowly changes to its recognizable colors. This plumage change also applies to adult Mallard males when they transition in and out of their non-breeding (eclipse) plumage at the beginning and the end of the summer moulting period. The adulthood age for Mallards is 14 months and the average life expectancy is 20 years. A noisy species, the male has a nasal call, and a high-pitched whistle, while the female has a deeper quack stereotypically associated with ducks. The Mallard is widely distributed across the Northern Hemisphere, North America from southern and central Alaska to Mexico, the Hawaiian Islands, and across Eurasia, from Iceland and southern Greenland and parts of Morocco (North Africa) in the west, Scandinavia to the north, and to Siberia, Japan, and China in the east. It is strongly migratory in the northern parts of its breeding range, and winters farther south. For example, in North America it winters south to Mexico, but also regularly strays into Central America and the Caribbean between September and May. The Mallard inhabits a wide range of habitat and climates, from Arctic Tundra to subtropical regions. It is found in both fresh- and salt water wetlands, including parks, small ponds, rivers, lakes and estuaries, as well as shallow inlets and open sea within sight of the coastline. They are attracted to bodies of water with aquatic vegetation. The Mallard is omnivorous and very flexible in its foods choice. Its diet may vary based on several factors, including the stage of the breeding cycle, short term variations in available food, nutrient availability, and inter- and intraspecific competition. The majority of the Mallard's diet seems to be made up of gastropods, invertebrates (including beetles, flies, lepidopterans, dragonflies, and caddisflies), crustaceans, worms, many varieties of seeds and plant matter, and roots and tubers. It usually feeds by dabbling for plant food or grazing; there are reports of it eating frogs. It usually nests on a river bank, but not always near water. It is highly gregarious outside of the breeding season and forms large flocks, which are known as a sord. Mallards usually form pairs (in October and November) only until the female lays eggs at the start of nesting season which is around the beginning of spring (early March to late May), at which time she is left by the male who joins up with other males to await the moulting period which begins in June. Unlike many waterfowl, Mallards have benefited from human alterations to the world. They are very adaptable, being able to live and even thrive in urban areas which may have supported more localized, sensitive species of waterfowl before development. The release of feral Mallards in areas where they are not native sometimes creates problems through interbreeding with indigenous waterfowl. These non-migratory Mallards interbreed with indigenous wild ducks from local populations of closely related species through genetic pollution by producing fertile offspring. Complete hybridization of various species of wild ducks gene pools could result in the extinction of many indigenous waterfowl. The wild Mallard itself is the ancestor of most domestic ducks and its naturally evolved wild gene pool gets genetically polluted in turn by the domesticated and feral populations.

Customer Reviews

4.7 out of 5 stars rating11.6K Total Reviews
9468 total 5-star reviews1280 total 4-star reviews374 total 3-star reviews174 total 2-star reviews285 total 1-star reviews
11,581 Reviews
Reviews for similar products
5.0 out of 5 stars rating
5 out of 5 stars rating
By D.December 11, 2020Verified Purchase
Ceramic Circle Ornament
Zazzle Reviewer Program
All the picture ornaments turned out well. There was a learning curve for me oh HOW to get the pictures just right. The colors turned out really well. Just a learning curve to get the photos placed just right.
5.0 out of 5 stars rating
5 out of 5 stars rating
By Mary C.February 7, 2022Verified Purchase
Ceramic Circle Ornament
Zazzle Reviewer Program
Lightweight, smooth, pure white ornament with nice sheen. Perfect size to be seen from across the room ... and to attract closer inspection! Price was great for ordering enough for the whole family! Clear, bold black design just as requested. Matches the order exactly. Just so nice!
5.0 out of 5 stars rating
5 out of 5 stars rating
By Michelle Z.January 2, 2022Verified Purchase
Ceramic Circle Ornament
Zazzle Reviewer Program
Very nice ornament. Not cheaply made. Print and photo quality on ornament is excellent

Custom Made Easy

  • Step 1: Choose your favorite design.

    Step 1:

    Choose your favorite design.

  • Step 2: Select your desired size, shape and paper type

    Step 2:

    Select your desired shape and material

  • Step 3: Click 'Personalize' to enter your custom text and images.

    Step 3:

    Click 'Personalize' to enter your custom text and images.

  • Step 4: When finished customizing your card, click 'Done' to see your final product!

    Step 4:

    When finished customizing, click 'Done' to see your final product!

Tags

Ornaments
christmasmallardduckwaterfowlnaturewildlifeanimalsalaskacanadaspanish
All Products
christmasmallardduckwaterfowlnaturewildlifeanimalsalaskacanadaspanish

Other Info

Product ID: 175716789410203768
Created on: 11/19/2015, 12:04 PM
Rating: G