Tap / click on image to see more RealViewsTM
Sale Price $24.31.  
Original Price $28.60 Comp. value
per ornament
You save 15%

Feliz Navidad - Mallards Metal Ornament

Qty:
Premium Square Ornament
-$9.70
-$9.70
-$6.05
-$6.05
-$9.70
-$10.90
-$10.90
-$10.90
-$7.30
-$7.30
-$7.30

Other designs from this category

About Ornaments

Sold by

Style: Premium Square Ornament

Create a fun, festive holiday keepsake by designing a premium square ornament. Add a family photo, or create a specific one for yourself, you spouse, and your children. They make wonderful gifts as well!

  • Dimensions:
    • 2" x 2" Sqaure
    • Weight: 1.5 oz.
  • Silver colored metal ornament
  • Full-color, full-bleed printing
  • UV Resistant and Waterproof
Designer Tip: To ensure the highest quality print, please note that this product’s customizable design area measures 1.84" x 1.84". For best results please add 1/16" bleed

About This Design

Feliz Navidad - Mallards Metal Ornament

Feliz Navidad - Mallards Metal Ornament

Two Mallard ducks, a drake and a female, swim together in an Alaskan pond. Spanish text reading, "Feliz Navidad" appears in red. The Mallard, Anas platyrhynchos, breeds throughout the temperate and subtropical Americas, Europe, Asia, and North Africa, and has been introduced to New Zealand and Australia. Male birds have a bright green or blue head, while the female's is light brown. The gregarious Mallard lives in wetlands and eats water plants. The Mallard is the ancestor of most domestic ducks. The Mallard was one of the many bird species originally described by Linnaeus in his 18th century work, Systema Naturae, and still bears the first binomial name it was given. The name is derived from the Old French malart or mallart "wild drake", although its ultimate derivation is unclear. It may be related to an Old High German masculine proper name Madelhart, clues lying in the alternate English forms "maudelard" or "mawdelard." Mallards frequently interbreed with their closest relatives in the genus Anas, such as the American Black Duck, and also with species more distantly related, for example the Northern Pintail, leading to various hybrids that may be fully fertile. This is quite unusual, and indicates that the Mallard evolved very rapidly during the Late Pleistocene. Mallards appear to be closer to their Indo-Pacific relatives than to their American ones judging from biogeography. Considering mtDNA D-loop sequence data, they may have evolved more probably than not in the general area of Siberia; Mallard bones rather abruptly appear in food remains of ancient humans and other deposits of fossil bones in Europe, without a good candidate for a local predecessor species.The large ice age paleosubspecies which made up at least the European and west Asian populations during the Pleistocene has been named Anas platyrhynchos palaeoboschas. The Mallard is 20–26 inches long (of which the body makes up around two-thirds), has a wingspan of 32–39 inches, and weighs 1.6–3.5 lbs. The size of the Mallard varies clinally, and birds from Greenland, although larger than birds further south, have smaller bills and are stockier. It is sometimes separated as subspecies, the Greenland Mallard (A. p. conboschas).The Mallard is a rare example of both Allen's Rule and Bergmann's Rule in birds. Bergmann's Rule, which states that polar forms tend to be larger than related ones from warmer climates, has numerous examples in birds. Allen's Rule says that appendages like ears tend to be smaller in polar forms to minimize heat loss, and larger in tropical and desert equivalents to facilitate heat diffusion, and that the polar taxa are stockier overall. Examples of this rule in birds are rare, as they lack external ears. However, the bill of ducks is very well supplied with blood vessels and is vulnerable to cold. Breeding males are unmistakable, with a bright bottle-green heads, a black rear end and a yellowish orange (can also contain some red) bill tipped with black (as opposed to the black/orange bill in females). They have a white collar which demarcates the head from the purple-tinged brown breast, grey brown wings, and a pale grey belly. The dark tail has white borders. The female Mallard is a mottled light brown, like most female dabbling ducks, and has buff cheeks, eyebrow, throat and neck with a darker crown and eye-stripe. Upon hatching, the plumage coloring of the duckling is yellow on the underside and face (with streaks by the eyes) and black on the backside (with some yellow spots) all the way to the top and back of the head. Its legs and bill are also black. As it nears a month in age, the duckling's plumage will start becoming drab, looking more like the female (though its plumage is more streaked) and its legs will lose their dark grey coloring. Two months after hatching, the fledgling period has ended and the duckling is now a juvenile. Between three to four months of age, the juvenile can finally begin flying as its wings are fully developed for flight (which can be confirmed by the sight of purple speculum feathers). Its bill will soon lose its dark grey coloring and whether it is male or female can finally be distinguished by three factors. The bill coloring is yellow in males, black and orange for females. The breast feathers are reddish-brown for males, brown for females. The center tail feather of male birds (called a drake feather) is curved; females have straight feathers. During the final period of maturity leading up to adulthood (6–10 months of age), the plumage of female juveniles remains the same while the plumage of male juveniles slowly changes to its recognizable colors. This plumage change also applies to adult Mallard males when they transition in and out of their non-breeding (eclipse) plumage at the beginning and the end of the summer moulting period. The adulthood age for Mallards is 14 months and the average life expectancy is 20 years. A noisy species, the male has a nasal call, and a high-pitched whistle, while the female has a deeper quack stereotypically associated with ducks. The Mallard is widely distributed across the Northern Hemisphere, North America from southern and central Alaska to Mexico, the Hawaiian Islands, and across Eurasia, from Iceland and southern Greenland and parts of Morocco (North Africa) in the west, Scandinavia to the north, and to Siberia, Japan, and China in the east. It is strongly migratory in the northern parts of its breeding range, and winters farther south. For example, in North America it winters south to Mexico, but also regularly strays into Central America and the Caribbean between September and May. The Mallard inhabits a wide range of habitat and climates, from Arctic Tundra to subtropical regions. It is found in both fresh- and salt water wetlands, including parks, small ponds, rivers, lakes and estuaries, as well as shallow inlets and open sea within sight of the coastline. They are attracted to bodies of water with aquatic vegetation. The Mallard is omnivorous and very flexible in its foods choice. Its diet may vary based on several factors, including the stage of the breeding cycle, short term variations in available food, nutrient availability, and inter- and intraspecific competition. The majority of the Mallard's diet seems to be made up of gastropods, invertebrates (including beetles, flies, lepidopterans, dragonflies, and caddisflies), crustaceans, worms, many varieties of seeds and plant matter, and roots and tubers. It usually feeds by dabbling for plant food or grazing; there are reports of it eating frogs. It usually nests on a river bank, but not always near water. It is highly gregarious outside of the breeding season and forms large flocks, which are known as a sord. Mallards usually form pairs (in October and November) only until the female lays eggs at the start of nesting season which is around the beginning of spring (early March to late May), at which time she is left by the male who joins up with other males to await the moulting period which begins in June. Unlike many waterfowl, Mallards have benefited from human alterations to the world. They are very adaptable, being able to live and even thrive in urban areas which may have supported more localized, sensitive species of waterfowl before development. The release of feral Mallards in areas where they are not native sometimes creates problems through interbreeding with indigenous waterfowl. These non-migratory Mallards interbreed with indigenous wild ducks from local populations of closely related species through genetic pollution by producing fertile offspring. Complete hybridization of various species of wild ducks gene pools could result in the extinction of many indigenous waterfowl. The wild Mallard itself is the ancestor of most domestic ducks and its naturally evolved wild gene pool gets genetically polluted in turn by the domesticated and feral populations.

Customer Reviews

4.7 out of 5 stars rating11.6K Total Reviews
9464 total 5-star reviews1281 total 4-star reviews373 total 3-star reviews174 total 2-star reviews283 total 1-star reviews
11,575 Reviews
Reviews for similar products
5 out of 5 stars rating
By Jennifer B.December 3, 2023Verified Purchase
Premium Square Ornament
Zazzle Reviewer Program
It’s a beautiful ornament. The silver is nice quality-it is smaller than I expected so just check the measurements of what you need. Turned out great for my son and his girlfriend to give them for Christmas to honor the first home they bought this year! It looks good, just hard to read the text because of the print and size.
5 out of 5 stars rating
By Sherri W.October 1, 2025Verified Purchase
Premium Square Ornament
This item is a beautiful piece of artwork. I am collecting for my “wall of jays”. The jays in this art are so typical of Jay behavior. It just makes me smile. Many thanks to the artist!!
5 out of 5 stars rating
By j h.January 16, 2024Verified Purchase
Premium Square Ornament
Zazzle Reviewer Program
I recently purchased the "A Season of Friendship" Premium Square Ornament, and I must say, it exceeded my expectations in every way. This beautifully crafted ornament is not only a delightful addition to my holiday decor but also a meaningful symbol of friendship that I'll cherish for years to come. The first thing that caught my eye was the exquisite design. The ornament features intricate details and vibrant colors that instantly evoke a sense of warmth and camaraderie. The depiction of friends sharing joyful moments is heartwarming and perfectly captures the spirit of the holiday season. Quality is paramount when it comes to ornaments, and this product does not disappoint. The materials used are of high quality, giving the ornament a luxurious feel. The square shape adds a unique touch, making it stand out among traditional round ornaments. It's evident that attention to detail was a top priority during the manufacturing process. The clarity of the image on the ornament is exceptional. Each detail is rendered with precision, allowing you to appreciate the intricate design that celebrates the essence of friendship. The clear image ensures that the ornament becomes a focal point, capturing the attention of anyone who sees it. The colors used in this ornament are nothing short of stunning. Rich, vivid hues bring the scenes of friendship to life, creating a visually appealing and emotionally resonant piece. The choice of colors adds warmth and charm, making it a perfect addition to your holiday decorations or as a year-round display of friendship.

Custom Made Easy

  • Step 1: Choose your favorite design.

    Step 1:

    Choose your favorite design.

  • Step 2: Select your desired size, shape and paper type

    Step 2:

    Select your desired shape and material

  • Step 3: Click 'Personalize' to enter your custom text and images.

    Step 3:

    Click 'Personalize' to enter your custom text and images.

  • Step 4: When finished customizing your card, click 'Done' to see your final product!

    Step 4:

    When finished customizing, click 'Done' to see your final product!

Tags

Ornaments
christmasmallardduckwaterfowlnaturewildlifeanimalsalaskacanadaspanish
All Products
christmasmallardduckwaterfowlnaturewildlifeanimalsalaskacanadaspanish

Other Info

Product ID: 175388903470958691
Created on: 11/19/2015, 12:17 PM
Rating: G