• Events
Tap / click on image to see more RealViewsTM
Sale Price $30.20.  
Original Price $33.55 Comp. value
per tie
You save 10%

First Fibonacci Plaid Nerdy Math Tartan Tie

Qty:

    Other designs from this category

    About Ties

    Sold by

    Style: Tie

    Upgrade your wardrobe a custom tie from Zazzle! Design one-of-a-kind ties to match any suit, dress shirt, and occasion. Upload your own unique images and patterns, or browse thousands of stylish designs to wear in the office or on a night out in the town.

    • Dimensions:
      • Length: 55"
      • Width: 4" (at widest point)
    • Printed in vibrant full color
    • Made from 100% polyester; silky finish
    • Double-sided printing available at small upcharge. Check out the "Design Area" tab to the right to customize
    • Dry clean only

    About This Design

    First Fibonacci Plaid Nerdy Math Tartan Tie

    First Fibonacci Plaid Nerdy Math Tartan Tie

    Plaid for math fans. This blue and green plaid pattern was created by converting the numbers of the Fibonacci sequence into hexadecimal and using those as the hex codes for the color then using the Fibonacci sequence to define the strand count.

    Customer Reviews

    4.5 out of 5 stars rating2.5K Total Reviews
    1812 total 5-star reviews325 total 4-star reviews143 total 3-star reviews73 total 2-star reviews117 total 1-star reviews
    2,470 Reviews
    Reviews for similar products
    5.0 out of 5 stars rating
    5 out of 5 stars rating
    By Jim L.March 10, 2013Verified Purchase
    Tie
    Creator Review
    The Pageant Tie is just what I wanted and everyone at church wants one. I have worn it several days now and each day more people come to me to see it and say how great it is. The printing is just as it should be. Each photo is clear and the color is great.
    5.0 out of 5 stars rating
    5 out of 5 stars rating
    By Cyane W.May 10, 2017Verified Purchase
    Tie
    Zazzle Reviewer Program
    This was such a hit! My brother was really excited to get it. The only thing he said was it was short -but he's 6'3" so it's hard for him to find ties that are long enough for him. Luckily, my other brother (who is the same height) managed to tie his tie so it fit, so he gave it to him. They both remarked on how much they like the ties and the material. Beautiful! Clear vibrant printing! The tie looks GREAT!
    5.0 out of 5 stars rating
    5 out of 5 stars rating
    By Henry B.November 30, 2025Verified Purchase
    Tie
    Oh my Goodness !!! I am very very humbled & gracious to obtain this handsome Boxing print necktie.. The quality is Superb. I being an very avid Boxing Enthusiasts will adorn this necktie with Boxing 🥊 Pride. Much Gratitude ! .

    Tags

    Ties
    fibonaccimathpatternplaidgeekynerdsmartfuncolorfulbright
    All Products
    fibonaccimathpatternplaidgeekynerdsmartfuncolorfulbright

    Other Info

    Product ID: 151220032616911856
    Created on: 2/20/2016, 12:52 PM
    Rating: G 
    Related Searches
    tiescustom necktie