Tap / click on image to see more RealViewsTM
Sale Price $27.84.  
Original Price $32.75 Comp. value
per tie
You save 15%

First Fibonacci Plaid Nerdy Math Tartan Tie

Qty:

Other designs from this category

About Ties

Sold by

Style: Tie

Upgrade your wardrobe a custom tie from Zazzle! Design one-of-a-kind ties to match any suit, dress shirt, and occasion. Upload your own unique images and patterns, or browse thousands of stylish designs to wear in the office or on a night out in the town.

  • Dimensions:
    • Length: 55"
    • Width: 4" (at widest point)
  • Printed in vibrant full color
  • Made from 100% polyester; silky finish
  • Double-sided printing available at small upcharge. Check out the "Design Area" tab to the right to customize
  • Dry clean only

About This Design

First Fibonacci Plaid Nerdy Math Tartan Tie

First Fibonacci Plaid Nerdy Math Tartan Tie

Plaid for math fans. This blue and green plaid pattern was created by converting the numbers of the Fibonacci sequence into hexadecimal and using those as the hex codes for the color then using the Fibonacci sequence to define the strand count.

Customer Reviews

4.5 out of 5 stars rating2.4K Total Reviews
1775 total 5-star reviews322 total 4-star reviews134 total 3-star reviews67 total 2-star reviews96 total 1-star reviews
2,394 Reviews
Reviews for similar products
5 out of 5 stars rating
By Jim L.March 10, 2013Verified Purchase
Tie
Creator Review
The Pageant Tie is just what I wanted and everyone at church wants one. I have worn it several days now and each day more people come to me to see it and say how great it is. The printing is just as it should be. Each photo is clear and the color is great.
4 out of 5 stars rating
By Emily L.October 30, 2019Verified Purchase
Tie
Zazzle Reviewer Program
I bought this tie for a cosplay of Haruhi Fujioka for Halloween and anime conventions. It feels very nice and silky. It's my first tie ever, and I'm a pretty big fan since I always wanted a tie. It was longer than I expected it to be (quite a plus), but the purple stripe was also thinner than I expected it to be (a slight bit of a downer, but I don't mind too much). I had never used Zazzle before, but I am very impressed with the shipping time. I was looking for places to get a tie like this so last minute since the ties like this on Amazon were incompatible with Prime. Thus, I ended up here. I paid for express shipping, expected delivery October 30-31, and it arrived in the morning on the 30th. Very impressed. I might just use Zazzle again. The print job was okay. The colors were perfect, but as you can see in the pictures, the stripe was a little off-center, and there was a kink in the stripe around where it transitions from the wide end to the thin end. It should work perfectly for my cosplay, but it was a little too carelessly print to be a very professional tie.
5 out of 5 stars rating
By Cyane W.May 10, 2017Verified Purchase
Tie
Zazzle Reviewer Program
This was such a hit! My brother was really excited to get it. The only thing he said was it was short -but he's 6'3" so it's hard for him to find ties that are long enough for him. Luckily, my other brother (who is the same height) managed to tie his tie so it fit, so he gave it to him. They both remarked on how much they like the ties and the material. Beautiful! Clear vibrant printing! The tie looks GREAT!

Tags

Ties
fibonaccimathpatternplaidgeekynerdsmartfuncolorfulbright
All Products
fibonaccimathpatternplaidgeekynerdsmartfuncolorfulbright

Other Info

Product ID: 151220032616911856
Created on: 2/20/2016, 12:52 PM
Rating: G 
Related Searches
tiespersonalized necktie