Tap / click on image to see more RealViewsTM
Sale Price $7.92.  
Original Price $9.30. Comp. value
Sale Price $1.32per coaster.
You save 15%

First Fibonacci Plaid Square Paper Coaster

Qty:
Square
+$0.05
+$0.05
+$0.05
+$0.05
+$0.05
+$0.05
+$0.05
+$0.05

Other designs from this category

About Paper Coasters

Sold by

Shape: Square

Don’t be the nagging host who follows guests around surreptitiously slipping coasters under their glasses. Ease your burden and add a personalized touch to your next party with fully customizable coasters. Balancing between reusable and disposable, these coasters perfectly transition from cocktail hours to receptions. Stock up today and never see a water ring again!

  • Dimensions: 4" x 4"
  • Material: Sturdy 50 pt. pulp board
  • Sold as sets of 6
  • Tough, durable, and absorbent – perfect for parties, weddings, or branding your business
  • Vibrant full-color one-sided printing

About This Design

First Fibonacci Plaid Square Paper Coaster

First Fibonacci Plaid Square Paper Coaster

Plaid for math fans. This blue and green plaid pattern was created by converting the numbers of the Fibonacci sequence into hexadecimal and using those as the hex codes for the color then using the Fibonacci sequence to define the strand count.

Customer Reviews

4.8 out of 5 stars rating606 Total Reviews
503 total 5-star reviews77 total 4-star reviews14 total 3-star reviews6 total 2-star reviews6 total 1-star reviews
606 Reviews
Reviews for similar products
5 out of 5 stars rating
By J.August 14, 2019Verified Purchase
Square Coasters
Zazzle Reviewer Program
Can't wait to use our new Christmas coasters! They are so very cute! I love the whimsical design. Well made, sturdy and sizeable! These coasters are perfect for large casual parties even safe to have out by the pool! Colors are dynamic and vibrant and just as pictured. Quality of print is crisp and well defined with no blur.
5 out of 5 stars rating
By Keicha B.December 6, 2020Verified Purchase
Square Coasters
Zazzle Reviewer Program
These were absolutely adorable!! I just loved having these to set out with my Bitmoji on them. Great I had no complaints at all,
5 out of 5 stars rating
By NyDivaz P.September 18, 2019Verified Purchase
Round Coasters
Zazzle Reviewer Program
Instead of ordering tickets for our paint night we decided to go with coasters for everyone's glass. It was perfect. Everyone loved their coasters most did not want to use but to keep has a memento enjoying both colors.

Tags

Paper Coasters
fibonaccimathpatternplaidgeekynerdsmartfuncolorfulbright
All Products
fibonaccimathpatternplaidgeekynerdsmartfuncolorfulbright

Other Info

Product ID: 256165514977023455
Created on: 3/1/2016, 10:14 AM
Rating: G