Tap / click on image to see more RealViewsTM
Sale Price $7.32.  
Original Price $8.10. Comp. value
Sale Price $1.22per coaster.
You save 10%

First Fibonacci Plaid Square Paper Coaster

Qty:
Square
+$0.05
+$0.05
+$0.05
+$0.05
+$0.05
+$0.05
+$0.05
+$0.05

Other designs from this category

About Paper Coasters

Sold by

Shape: Square

Don’t be the nagging host who follows guests around surreptitiously slipping coasters under their glasses. Ease your burden and add a personalized touch to your next party with fully customizable coasters. Balancing between reusable and disposable, these coasters perfectly transition from cocktail hours to receptions. Stock up today and never see a water ring again!

  • Dimensions: 4" x 4"
  • Material: Sturdy 50 pt. pulp board
  • Sold as sets of 6
  • Tough, durable, and absorbent – perfect for parties, weddings, or branding your business
  • Vibrant full-color one-sided printing

About This Design

First Fibonacci Plaid Square Paper Coaster

First Fibonacci Plaid Square Paper Coaster

Plaid for math fans. This blue and green plaid pattern was created by converting the numbers of the Fibonacci sequence into hexadecimal and using those as the hex codes for the color then using the Fibonacci sequence to define the strand count.

Customer Reviews

4.8 out of 5 stars rating630 Total Reviews
524 total 5-star reviews78 total 4-star reviews15 total 3-star reviews6 total 2-star reviews7 total 1-star reviews
630 Reviews
Reviews for similar products
5.0 out of 5 stars rating
5 out of 5 stars rating
By J.August 14, 2019Verified Purchase
Square Coasters
Zazzle Reviewer Program
Can't wait to use our new Christmas coasters! They are so very cute! I love the whimsical design. Well made, sturdy and sizeable! These coasters are perfect for large casual parties even safe to have out by the pool! Colors are dynamic and vibrant and just as pictured. Quality of print is crisp and well defined with no blur.
5.0 out of 5 stars rating
5 out of 5 stars rating
By Charmtastic M.March 16, 2026Verified Purchase
Round Coasters
The "Charm'tastic Mile" Metal-Art Logo O's Colorway Bar/Restaurant coaster was absolutely amazing. Another 5-star product from Zazzle. .
5.0 out of 5 stars rating
5 out of 5 stars rating
By Charmtastic M.May 11, 2026Verified Purchase
Round Coasters
The "Charm'tastic Mile" 10th Anniversary (2016-26) Metal-Art Logo on a coaster looks amazing. Another 5-star product from ZAZZLE. Thank you. .

Tags

Paper Coasters
fibonaccimathpatternplaidgeekynerdsmartfuncolorfulbright
All Products
fibonaccimathpatternplaidgeekynerdsmartfuncolorfulbright

Other Info

Product ID: 256165514977023455
Created on: 3/1/2016, 10:14 AM
Rating: G