Tap / click on image to see more RealViewsTM
Sale Price $41.23.  
Original Price $48.50 Comp. value
per window cling
You save 15%

Forest Wolf Night Sky Wilderness Animal Art Window Cling

Qty:
24" x 24"
Automatic Opaque Design: White Underbase
Custom Cut

Other designs from this category

About Window Clings

Sold by

Shape: Custom Cut

Turn your glass surfaces into decorations, promotions, signage and more with custom window clings. These versatile and reusable vinyl clings stick to glass surfaces through static electricity so leave no sticky residue behind. From displaying new promotions on your business’s window and using that empty window space to boost your brand, to decorating a window in your home, you’ll find so many great uses for these clings.

  • Dynamically Sized - ranging from 4” x 4” to a max of 52” x 72” (or max 72” x 52” if horizontal/landscape is selected)
  • Material - 7.5 mil static cling vinyl
  • Non Adhesive: Sticks to glass surfaces electro-statically
  • Choose from rectangle or custom cut shapes

Application Instructions:

  • Clean the surface you wish to apply the window cling to with hot water and dishwasher soap and wait until dry
  • Next, apply a light mist of water to your surface. Peel the decal from backing paper and place it on your surface, slide it around until you’re happy with its placement
  • Once it’s positioned perfectly, use a squeegee or flat plastic card to remove any air bubbles and wipe your window dry
  • To reposition or remove, simply peel away. It’s non-adhesive so there’ll be no residue left on the surface

Print Process: Automatic Opaque Design: White Underbase

Art is printed on a transparent sheet of plastic, but white ink is printed beneath all art, making those areas opaqaue while also making colors vivid

Adhesive: Cling art faces outwards

Adhesive side is on the front of the window cling. All text and art is printed on the front of the window cling and faces away from the person applying it to the window. The art and text printed on the window cling will appear correctly when viewed from the opposite side of the window that it has been applied to.

About This Design

Forest Wolf Night Sky Wilderness Animal Art Window Cling

Forest Wolf Night Sky Wilderness Animal Art Window Cling

Forest Wolf Night Sky Wilderness Animal Art Window Cling

Customer Reviews

3.6 out of 5 stars rating199 Total Reviews
117 total 5-star reviews11 total 4-star reviews7 total 3-star reviews10 total 2-star reviews54 total 1-star reviews
199 Reviews
Reviews for similar products
5 out of 5 stars rating
By Evgeny P.November 6, 2025Verified Purchase
Window Cling, Size: 4.00" x 4.00", Style: Automatic Opaque Design: White Underbase, Shape: Rectangle, Display: Back of Cling
Creator Review
Went out stylish. The cut lines are thin, and extra light definitely helps when cutting. Love the end result!
5 out of 5 stars rating
By PCS I.October 3, 2025Verified Purchase
Window Cling, Size: 11.00" x 8.00", Style: Opaque Design: All-over White Underbase, Shape: Rectangle, Display: Back of Cling
Wow these are great. Great quality, great price, and great look ! The "cling" works great, put these up weeks ago and they still are "clung" with no issues whatsoever!! We'll done! A+.
1 out of 5 stars rating
By AnonymousSeptember 6, 2024Verified Purchase
Window Cling, Size: 8.00" x 11.00", Style: Automatic Opaque Design: White Underbase, Shape: Rectangle, Display: Back of Cling
This is RIDICULOUS! Extremely poor quality. And to think I had to wait even longer to receive my order because was delayed. Not happy at all with this order.

Tags

Window Clings
forest wolf night skywilderness animal art window clingforestwolfnightskywildernessanimalartwindow
All Products
forest wolf night skywilderness animal art window clingforestwolfnightskywildernessanimalartwindow

Other Info

Product ID: 256973010613971893
Created on: 11/20/2023, 2:52 PM
Rating: G