Tap / click on image to see more RealViewsTM
Sale Price $28.48.  
Original Price $33.50 Comp. value
per wall decal
You save 15%

Full Moon and Bats Wall Decal

Qty:
12" x 12"

Other designs from this category

About Wall Decals

Sold by

Print Process: Partial Transparent Design: No Underbase

Art is printed on a transparent sheet of plastic making all art translucent.

Shape: Custom Cut

Wall Decals can be easily applied, removed, and repositioned without leaving damage or a sticky residue. They can be used on walls or any other smooth surface like - Mirrors, Doors, Drawer Cabinets and more. Wall decals are perfect for branding, decoration and promotions. These decals are not designed to stick on rough or uneven surfaces such as stucco, cinder block, and brick.

  • Reusable design is safe for walls
  • Sticks to most smooth, flat surfaces
  • No tape or tacks required

About This Design

Full Moon and Bats Wall Decal

Full Moon and Bats Wall Decal

This awesome shaped Halloween wall decal features a big bright yellow full moon with two black bats flying across it. The background is red creating the appearance of a blood red sky.

Customer Reviews

5.0 out of 5 stars rating1 Total Reviews
1 total 5-star reviews0 total 4-star reviews0 total 3-star reviews0 total 2-star reviews0 total 1-star reviews
1 Reviews
Reviews for similar products
5 out of 5 stars rating
By Kristle G.August 26, 2022Verified Purchase
Zazzle Reviewer Program
Excited to display this decal on a mirror for my wedding! The quality is great! Shipping and production was quick. Looks just like the preview!
Original product

Tags

Wall Decals
wall decalsbatsmoonhalloweenspookymammalsanimalscreepyfreakyscary
All Products
wall decalsbatsmoonhalloweenspookymammalsanimalscreepyfreakyscary

Other Info

Product ID: 256665363194370024
Created on: 6/15/2022, 7:36 AM
Rating: G